KEGG   Pseudomonas fulva: Psefu_4223Help
Entry
Psefu_4223        CDS       T01501                                 

Definition
(GenBank) formaldehyde dehydrogenase, glutathione-independent
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pfv  Pseudomonas fulva
Pathway
pfv00625  Chloroalkane and chloroalkene degradation
pfv00680  Methane metabolism
pfv01100  Metabolic pathways
pfv01120  Microbial metabolism in diverse environments
pfv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfv00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Psefu_4223
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Psefu_4223
Enzymes [BR:pfv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Psefu_4223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AEF24175
UniProt: F6A8M0
Position
complement(4607944..4609143)
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGTGKVEVQKIDYPKMQDPRGRKIEHGVILKVVSTNICGSDQHMVRGRTTA
QVGLVLGHEITGEVVEKGSDVESLKIGDLVSVPFNVACGRCRSCKEQHTGVCLTVNPARA
GGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPDRDKAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYVAGAGPVGLAAAASARLLGAAVVIVGDVNPVRLAHAKAQGFEIADLSKD
TPLHEQIADLLGEPEVDCAVDAVGFEARGHGHAGAQHEAPATVLNSLMQVTRVAGKIGIP
GLYVTEDPGAVDAAAKIGSLSIRFGLGWAKSHSFHTGQTPVMKYNRALMQAIMWDRINIA
EVVGVQVISLDDAPRGYGEFDAGVPKKFVIDPHKMFSAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtaatcgcggtgtcgtctatctcggcacaggcaaggtcgaagttcagaagatc
gactatccgaagatgcaggatccgcgcggtcgcaagatcgagcacggcgtgatcctcaag
gtcgtttccaccaacatctgcggctccgaccagcacatggtgcgtggccgtaccaccgct
caggtcggcctggtgctcggccacgagatcaccggcgaggtggtcgagaaggggagcgac
gtcgaaagcctgaagatcggtgacctggtttccgtgcccttcaacgtcgcctgcggccgc
tgccgctcctgtaaagagcagcacaccggtgtgtgcctgaccgtcaatccggcccgtgcc
ggcggcgcctacggctacgtcgacatgggcgactggaccggtggccaggccgaatacgtg
ctggtgccttacgctgacttcaacctgctcaagctgccggaccgcgacaaggccatggag
aagatccgcgacctgacctgcctgtccgacattctgcccaccggctatcacggcgcggtg
actgccggcgttggcccgggctccaccgtttacgtggccggtgccggcccggtcggtttg
gccgccgccgcctcggcgcgcctgctcggcgccgcggtggtgatcgtcggtgacgtcaac
ccggtgcgcctggcccatgccaaggcccagggcttcgaaatcgccgacctgtccaaggac
accccgctgcacgaacagatcgccgacctgctcggtgagccggaagtcgattgcgccgtc
gacgcggtgggcttcgaggcccgcggtcatggccatgccggtgcccagcacgaagcaccg
gccaccgtactcaactcgctgatgcaggtcacccgcgtggccggcaagatcggtatcccc
ggcctgtacgtcaccgaagacccgggcgcggtggacgcggcagccaagatcggcagcctg
agcatccgtttcggcctcggctgggccaagtcgcacagcttccacaccggccagacccca
gtgatgaagtacaaccgcgcattgatgcaggccatcatgtgggaccgcatcaacatcgcc
gaagtggtgggcgtgcaggtcatcagcctggacgacgcaccgcgcggttacggcgagttc
gatgccggcgtgccgaagaaattcgtcatcgacccgcacaagatgttcagcgctgcctga

DBGET integrated database retrieval system