KEGG   Pseudomonas fulva: Psefu_4368
Entry
Psefu_4368        CDS       T01501                                 

Definition
(GenBank) type VI secretion system Vgr family protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
pfv  Pseudomonas fulva
Pathway
pfv03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pfv00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Psefu_4368
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pfv02044]
    Psefu_4368
Secretion system [BR:pfv02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Psefu_4368
SSDB
Motif
Pfam: Phage_GPD Gp5_C Phage_base_V
Other DBs
NCBI-ProteinID: AEF24320
UniProt: F6AA93
Position
4768783..4771008
AA seq 741 aa
MAITQQSRMAKVNSPLGENALVMERLAGNESLGRLFHYELSLASENSSLKLNALLGKPMG
LAVQLADGSDRYFHGIVARCSQTAHRGQFASYQVTLKPWLWLLSRTSDCRIFQSKTVPDI
VKQVFRDLGFSDFEDALTRSYREWDYCVQYRETSFDFVSRLMEQEGIYYYFRHEQERHVL
VLCDAYGAHSTAPGYGRVPFYPLDDQMRERDHIHDWHLAHEVQPGSLALNDYDFQRPSAR
LEVRSSIAREHANADYPLYDYPGEYVQSKDGEQYARNRIEAIQAQYEQIRLKGNARGLGS
GHLFSLTDYPRDDQNREYLIVDAEYTITQDLYESGRGSESFQFDSSLTCIDASQVFRPLP
LTVQPIVQGPQTAMVVGPKGEEIWTDQYGRVKVHFYWDRHDQSNENSSCWIRVSQNWAGK
NWGSIQIPRIGQEVIVSFLEGDPDRPIITGRVYNAEQTVPYDLPANATQSGTKSRSSKGG
TPANFNEIRMEDKKGEEQLFIHAEKNQDIEVENDETHWVGHDRTKTIDNDETVHVKHDRT
ETVDNNETITIGVDRTEKVGNNESITIGVNRSEKVGSNETIAIGANRTETVGSDETISIG
ANRTESVGSNETISIGANRTESVGNNERTTIGADRTALITANEYVLVGADQANMVGGNES
HYVRGERNSRVLKDDNLHVGKNFVLKAGDSITLQTGAASIVMKKDGTIVIRGKNISIDGS
GAINVKAAKNIVMKGQKILQN
NT seq 2226 nt   +upstreamnt  +downstreamnt
atggcaatcacacaacagtcgcgcatggccaaggtcaacagcccgctcggcgaaaacgcg
ctggtgatggagcgcctggccggcaacgaatccctgggccgcctgttccactacgagctc
agcctggcctcggaaaactcctcgctcaagctcaatgccctgctcggcaagcccatgggc
ctggccgtgcaactggccgacggcagcgaccgctacttccacggcatcgtcgcgcgctgc
agccagaccgcccaccgcggccagttcgccagctatcaggtcaccctcaagccctggtta
tggctgctgtcgcgcacctccgactgccgcatcttccagagcaagacggtgccggacatc
gtcaagcaggtgttccgcgacctgggtttctcggacttcgaagacgccctgacccgctcc
taccgcgagtgggactattgcgtgcagtatcgcgagaccagcttcgatttcgtcagccgg
ctgatggagcaggaaggcatctactactacttccgccacgagcaggagcgccatgtgctg
gtgctctgcgatgcctatggtgcccacagcacggcgcccggatatgggcgcgtgcccttc
tatccgctcgacgaccagatgcgcgagcgtgaccacatccacgactggcacctggcccac
gaggtgcagcccggctccctggcgctcaacgactacgacttccagcgccccagcgcacgc
ctggaagtgcgctccagcatcgcccgcgagcacgccaacgccgattatccgctctacgac
tacccgggcgagtacgtgcagagcaaggacggcgagcagtacgcgcgcaatcgcatcgag
gcgatccaggcgcagtacgagcagatccgcctgaagggcaatgcccgaggcctgggcagc
gggcacctgttcagccttaccgattacccgcgcgacgatcagaaccgcgagtacctgatc
gtcgatgccgaatacaccatcacccaggatctctacgaaagcggccgcggcagcgagagc
ttccagttcgacagcagcctgacctgcatcgacgccagccaggtgttccgcccgctgccg
ctgaccgtgcagcccatcgtgcagggcccgcagacggccatggtggtcggcccgaagggc
gaggaaatctggaccgaccagtacggccgcgtgaaggtgcacttctactgggaccgccac
gaccaatccaacgagaacagctcgtgctggattcgcgtgtcgcagaactgggccggcaag
aactggggctcgattcagattccgcgcatcggccaggaagtgatcgtcagctttctggag
ggcgaccccgaccggccgatcatcaccggccgcgtctacaacgccgagcagacggtgccc
tacgacctgcccgccaacgccacgcaaagcggcaccaagagccgctcgagcaagggtggc
acgccggccaacttcaacgaaatccgcatggaagacaagaagggcgaagagcagctgttc
atccatgccgagaagaaccaggacatcgaggttgagaacgacgagacccactgggtcggc
cacgaccgcaccaagaccatcgacaacgacgaaacggtgcacgtcaaacacgaccgcacc
gagacggtggacaacaacgagaccatcaccatcggcgtcgatcgtaccgaaaaggtcggc
aacaacgagtccatcaccatcggcgtgaaccgcagcgagaaggtcggcagcaacgagacc
atcgccatcggcgccaaccgtaccgagaccgtcggcagcgatgaaaccatcagcatcggc
gccaaccgcaccgagagcgtgggcagcaacgaaaccatcagcatcggcgccaaccgcacc
gaaagcgtcggcaacaacgagcgcaccaccatcggtgccgaccgcaccgcgctgatcact
gccaacgagtacgtgctcgtcggtgcagaccaggcgaacatggtgggcggcaacgagtcg
cactatgtgcgtggcgagcgcaacagccgcgtcctcaaggatgacaatctgcatgtcggc
aagaacttcgtgctcaaggccggcgactcgatcaccctgcagaccggcgctgccagcatc
gtcatgaagaaggacggcaccatcgtcattcgtggcaagaacatcagcatcgacggctcc
ggggcgatcaacgtcaaggccgccaagaacatcgtgatgaaaggccagaagatcctgcag
aactag

DBGET integrated database retrieval system