KEGG   Pseudomonas simiae PCL1751: PF1751_v1c02280Help
Entry
PF1751_v1c02280   CDS       T03766                                 

Gene name
ompR
Definition
(GenBank) DNA-binding response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
pfw  Pseudomonas simiae PCL1751
Pathway
pfw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pfw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PF1751_v1c02280 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:pfw02022]
    PF1751_v1c02280 (ompR)
Two-component system [BR:pfw02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   PF1751_v1c02280 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AJP49935
UniProt: A0A4U3GJN0
Position
262399..263139
Genome map
AA seq 246 aa AA seqDB search
MSSTAQTAEGEKILIVDDDPGLSSLLERFFNSKGYRARAVPNTEQMDRLLGREVFNLVVL
DLMLPGEDGLTACKRLRGANNQIPIIMLTAKGDELSRIKGLELGADDYLAKPFNPDELMA
RVKAVLRRQAAPVPGAPGSEDESVTFGDYELSLATRELKRGDEVHMLTTGEFAVLKALVM
NARQPLTRDKLMNLARGREWDALERSIDVQISRLRRMIEPDPSKPRYIQTVWGVGYVFVP
DGNKTS
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcactgcacaaactgctgaaggcgaaaaaattctcatcgttgacgacgatccg
gggctgagcagcctgctggagcgtttcttcaactccaagggctatcgcgcccgtgcggtg
ccgaacaccgagcagatggaccgcctgttggggcgtgaagtcttcaacctggtcgtactc
gatctgatgctgcccggcgaagacggcctgaccgcctgcaaacgcctgcgcggcgcaaac
aaccagattccaatcatcatgctcaccgccaagggtgatgagctgagtcgcatcaagggc
ctcgaactgggcgccgatgactacctggccaagcctttcaaccctgacgagctgatggcg
cgggtgaaggccgtgttgcgtcgccaggcagccccggtaccgggtgcaccaggcagcgaa
gacgaaagcgtcacctttggcgactacgaactgtcgctggcgacccgtgagctaaagcgt
ggcgatgaagtgcacatgctgaccaccggcgaattcgccgtgctcaaggccctggtgatg
aacgctcgccagccgctgactcgcgacaagctgatgaacctcgcccgtggccgggaatgg
gatgcgctggagcggtccatcgacgtacagatctcccgtctgcgtcggatgatcgagccg
gacccgtccaagccgcggtatatccagacggtgtggggcgtcggttatgtgtttgttccg
gacggcaataaaaccagttga

DBGET integrated database retrieval system