KEGG   Pseudomonas simiae PCL1751: PF1751_v1c02360Help
Entry
PF1751_v1c02360   CDS       T03766                                 

Gene name
pckA
Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
pfw  Pseudomonas simiae PCL1751
Pathway
pfw00010  Glycolysis / Gluconeogenesis
pfw00020  Citrate cycle (TCA cycle)
pfw00620  Pyruvate metabolism
pfw01100  Metabolic pathways
pfw01110  Biosynthesis of secondary metabolites
pfw01120  Microbial metabolism in diverse environments
pfw01130  Biosynthesis of antibiotics
pfw01200  Carbon metabolism
Module
pfw_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pfw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PF1751_v1c02360 (pckA)
   00020 Citrate cycle (TCA cycle)
    PF1751_v1c02360 (pckA)
   00620 Pyruvate metabolism
    PF1751_v1c02360 (pckA)
Enzymes [BR:pfw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     PF1751_v1c02360 (pckA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33 AAA_25 AAA_24 AAA_29
Motif
Other DBs
NCBI-ProteinID: AJP49943
Position
269438..270979
Genome map
AA seq 513 aa AA seqDB search
MTQANNAVYTDLSVDDLVKEALQRGEGVLADTGALVVETGHRTGRSPVDRFIVEEPTTQD
AIAWGPINRKFPADKFDALWARVEAFNNAQEHFVSHVHVGASEDHYLAVKMTTQTAWQNL
FGRCLFINPAQYNPAGREEWQVLNVANFECVPERDGTNSDGCVILNFAQKKVLIAGMRYA
GEMKKAMFSVQNFLLPASDVLPMHCAANIGEAGDVTLFFGLSGTGKTTLSADESRYLIGD
DEHGWGEGVVFNIEGGCYAKCIDLSEKNEPVIWKAIKHGAVLENVVIDGAKHADYTNVSL
TQNSRAAYPLEHVAKRSEKNLGGEPNAVIFLTCDLTGVLPPVSILSEEQAAYHFLSGYTA
LVGSTEMGSGGGIKSTFSTCFGAPFFPRPAGEYAELLIKRIRGFGSKVYLVNTGWTGGGY
GVGKRFNIPTTRGVIAAIQSGALIGAETEHLDTINLDVPLAVPGVETGLLNPRNTWADKA
AYDEAAKALAGLFIENFKKFEVSDAIKAAGPKL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagccaacaacgccgtatacaccgatctgagtgttgacgatctggttaaagaa
gccctgcagcgtggtgaaggcgtgctcgccgatactggcgcgctggtcgtcgaaaccggt
caccgtactggccgttcgccggtcgaccgtttcatcgttgaagagcctactacccaggac
gctatcgcctggggcccgatcaaccgcaagttcccggccgacaagttcgatgccctgtgg
gctcgcgtcgaggcgttcaacaacgcgcaagagcacttcgtttcccacgttcacgtaggg
gcttccgaagaccactacctggctgtgaaaatgaccacccagactgcctggcagaacctg
ttcggtcgttgcctgttcatcaacccggcccagtacaacccggccggtcgtgaagagtgg
caagtgcttaacgtggccaacttcgagtgcgtgcctgagcgtgacggcaccaactccgac
ggttgcgtgatcctcaacttcgcccagaagaaagtgctgatcgccggcatgcgttacgcc
ggtgaaatgaaaaaagccatgttctcggtgcagaacttcctgctgccggcttccgacgtg
ctgccgatgcactgcgctgccaacattggcgaagcaggcgacgtgaccctgttcttcggt
ctgtcgggcaccggtaaaaccaccctgtccgccgacgaaagccgttacctgatcggtgac
gacgaacacggctggggcgaaggcgtggtgttcaacatcgaaggcggttgctatgccaag
tgcatcgacctgtccgagaagaacgagcccgtcatctggaaagccatcaagcacggcgcc
gtgctggaaaacgtggtgatcgacggtgccaagcacgccgactacaccaacgtcagcctg
acccagaacagccgtgccgcctacccgctggagcacgttgccaagcgttccgagaagaac
ctgggcggcgagccaaacgcagtgatcttcctgacctgcgacctgaccggcgtattgcca
cctgtgtccatcctcagcgaagaacaagcggcctaccatttcctctccggctacaccgca
ctggtgggttcgaccgaaatgggttccggcggtggtatcaagtcaaccttctccacctgc
tttggcgcaccgttcttcccgcgcccggctggcgaatacgctgagctgctgatcaagcgc
atccgtggcttcggctccaaggtctacctggtcaacaccggctggaccggcggcggctac
ggcgtcggcaagcgcttcaacatcccgactactcgcggcgtcatcgcagcgatccagagc
ggtgcgttgatcggtgcagaaaccgaacacctcgacaccatcaacctcgacgtgccactg
gctgtgccaggcgttgagaccggcctgttgaacccacgtaatacctgggctgacaaggct
gcgtatgacgaagcggcgaaggcgctggcgggtctgttcatcgaaaacttcaagaagttt
gaagtgagcgatgcgatcaaggctgcgggtcctaagttgtaa

DBGET integrated database retrieval system