KEGG   Pseudomonas fluorescens PCL1751: PF1751_v1c13510Help
Entry
PF1751_v1c13510   CDS       T03766                                 

Definition
(GenBank) class II aldolase/adducin domain protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pfw  Pseudomonas fluorescens PCL1751
Pathway
pfw00051  Fructose and mannose metabolism
pfw01100  Metabolic pathways
pfw01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    PF1751_v1c13510
Enzymes [BR:pfw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     PF1751_v1c13510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AJP51057
Position
complement(1528980..1529762)
Genome map
AA seq 260 aa AA seqDB search
MAKTLALPKDQLVKQALVQMQNTLADNTWTDRQKLALTCRILFENGHDSGLAGQITARGP
EQGTYYTQQLGLGFDEITASNLLLVNEDLEVLEGHGIPNPANRFHSWVYRGRPDVNCIIH
THPTHIAALSMLEVPLQVSHMDLCPLYEDCAFLEAWPGVPVGNEEGEIITTALGDKRAIL
LSHHGQLSTGASIEEACVIAQLIERAAKLQLLAMSAGTIKPILPELGREAHDWISRPKRH
GAAFNYYARQNLRQHADCLN
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccaagacattagcactcccaaaagaccaactggtcaagcaagcactcgtccagatg
caaaacaccctggcagataatacgtggactgaccggcaaaagctggcgctcacttgccgc
atcctgttcgagaacggccacgactctggcctcgccgggcagatcaccgcgcgcgggccg
gaacagggcacctattacactcagcaattgggcctgggttttgatgagatcaccgccagc
aacctgttgctggtaaacgaggatcttgaagtactggaaggccacggcatccccaacccc
gccaaccgttttcacagctgggtctaccgtgggcggccggacgtaaactgcatcatccac
actcatcccacccatatcgccgcgctgtcgatgctggaagtgccgctgcaggtgtcccat
atggacctttgcccgctgtacgaagactgcgccttcctggaggcttggccgggcgtaccg
gtgggcaatgaagaaggcgaaatcattaccacggcactgggtgacaaacgcgcgatcctg
ctttcgcaccacggtcagttgtccaccggggcgagcattgaggaggcctgcgtgatcgcg
cagttgatcgagcgcgcggccaaattgcagttgctggcgatgtcggccggcaccatcaag
ccgatcctgccggagctgggacgcgaggcccacgactggatctcccgacccaagcgccat
ggcgccgcgttcaactactacgcccggcagaacctgcgtcaacacgccgattgcctgaac
tga

DBGET integrated database retrieval system