KEGG   Pseudomonas simiae PCL1751: PF1751_v1c14760Help
Entry
PF1751_v1c14760   CDS       T03766                                 

Definition
(GenBank) hypothetical protein
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
pfw  Pseudomonas simiae PCL1751
Pathway
pfw00053  Ascorbate and aldarate metabolism
pfw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    PF1751_v1c14760
Enzymes [BR:pfw01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     PF1751_v1c14760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL
Motif
Other DBs
NCBI-ProteinID: AJP51181
UniProt: A0A4U3G2B8
Position
1649174..1650052
Genome map
AA seq 292 aa AA seqDB search
MRIEVLVDVKTTLGEGPVWDVEQQRLYWIDSADGRILRCTDDGRELRAWEVGQKIGSMAL
RQDGESAIVALQNGVHTLDLKSGELNLIADPEPHLPDNRLNDGKVDRQGRFIFGSMDTQE
DNASAKLYRLDADLSLHTLDEGIIVSNGPCWSPSGDTFYFCDTWSGEIWAYDYDLATGNV
SNRRTFAKVDTRGGGAADGCTVDAEGCLWQALVYAGKLVRYTPEGFVDRIIQMPVKKVTS
LTFGGPNLDTLFVTSMAKPPLPRFPADGQQRGALFAITGLGVQGIAERRFAS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcgaagtgcttgtcgacgtcaagaccaccctgggcgaaggcccggtgtgggac
gtcgagcaacaacgcttgtattggatcgacagcgccgacggccgcatcctgcgctgcacc
gacgacggccgcgaactgcgcgcctgggaggtgggccagaaaatcggctccatggccctg
cgccaggacggtgagtcggccattgtcgccctgcaaaacggcgtgcacacactcgacctc
aagagcggtgaactcaacctgatcgctgatccggaaccgcatctgccagacaaccgcctc
aacgacggcaaggtcgaccgccagggccgctttatcttcggctccatggacacccaggaa
gacaacgccagcgccaagctttaccgcctggacgccgacctgagcctgcacaccctggac
gaaggcatcatcgtgtccaacggcccgtgctggagcccgtcgggtgacaccttctacttc
tgcgacacctggtccggcgagatctgggcctacgactacgacctcgccaccggcaacgtg
agcaaccgccgcaccttcgccaaggtcgatacccgcggcgggggcgccgccgatggttgc
accgtggatgccgaaggctgcctatggcaggcgttggtctatgccgggaagctggtgcgc
tataccccagaaggttttgtcgaccgcatcatccagatgccggtgaaaaaggtcaccagc
ctgacttttggcgggccgaatctggacaccctgtttgtgacttccatggccaagccgccg
ttgccgcgttttccggcagacggccagcagcgcggagcgctgttcgccattaccgggttg
ggcgtgcaaggaatagccgagcgacggttcgccagctag

DBGET integrated database retrieval system