KEGG   Pseudomonas fluorescens PCL1751: PF1751_v1c27010Help
Entry
PF1751_v1c27010   CDS       T03766                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pfw  Pseudomonas fluorescens PCL1751
Pathway
pfw00071  Fatty acid degradation
pfw00072  Synthesis and degradation of ketone bodies
pfw00280  Valine, leucine and isoleucine degradation
pfw00310  Lysine degradation
pfw00362  Benzoate degradation
pfw00380  Tryptophan metabolism
pfw00620  Pyruvate metabolism
pfw00630  Glyoxylate and dicarboxylate metabolism
pfw00640  Propanoate metabolism
pfw00650  Butanoate metabolism
pfw00900  Terpenoid backbone biosynthesis
pfw01100  Metabolic pathways
pfw01110  Biosynthesis of secondary metabolites
pfw01120  Microbial metabolism in diverse environments
pfw01130  Biosynthesis of antibiotics
pfw01200  Carbon metabolism
pfw01212  Fatty acid metabolism
pfw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pfw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PF1751_v1c27010
   00630 Glyoxylate and dicarboxylate metabolism
    PF1751_v1c27010
   00640 Propanoate metabolism
    PF1751_v1c27010
   00650 Butanoate metabolism
    PF1751_v1c27010
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PF1751_v1c27010
   00072 Synthesis and degradation of ketone bodies
    PF1751_v1c27010
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PF1751_v1c27010
   00310 Lysine degradation
    PF1751_v1c27010
   00380 Tryptophan metabolism
    PF1751_v1c27010
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PF1751_v1c27010
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PF1751_v1c27010
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PF1751_v1c27010
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfw04147]
    PF1751_v1c27010
Enzymes [BR:pfw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PF1751_v1c27010
Exosome [BR:pfw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PF1751_v1c27010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJP52401
Position
complement(3060514..3061698)
Genome map
AA seq 394 aa AA seqDB search
MTDPIVIVSAVRTPMGGFQGDLKGLTAPQLGSAAIRAAVERAGIATDAVDEVLFGCVLPA
GLGQAPARQAALGAGLDKATRCTTLNKMCGSGMEAAILAHDSLLAGSVDVVIAGGMESMS
NAPYLLDRARSGYRMGHGKVLDHMFLDGLEDAYDKGRLMGTFAEDCALHNGFTREAQDAF
AIASLTRAQEAISHGNFAAEIVPVQVTVGKEQKTILHDEQPPKAKLDKISSLKPAFRDGG
TVTAANASSISDGAAALLLMRQSEAQKRGLKPLAVIHGHAAFADEPGLFPVAPVGAIRKL
MTKTGWNVGEVDLFEINEAFAVVSLVTMSKLDIPHAKVNIHGGACALGHPIGASGARILV
TLLSALRQNGLKRGVAAICIGGGEATAMAVECLY
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccccatcgttattgtcagcgccgtgcgcacgcccatgggcgggtttcagggt
gatctcaagggcttgactgcgccgcagctgggttccgccgccattcgtgcggcggtcgag
cgtgccggtatcgccaccgatgccgtggatgaagtgctgttcggctgcgtactgcccgct
ggcctcggccaggcacccgcacgccaggcggcgttgggcgcgggcctggacaaggccacg
cgctgcaccaccctcaacaagatgtgcggctcgggcatggaagccgcgatcctggcgcat
gattcgctgctggccggcagcgttgatgtggtcatcgccggtggcatggaaagcatgtcc
aacgcaccgtacctgctggaccgcgcccgcagcggctaccgcatggggcacggcaaggtg
ctcgaccacatgttccttgacggtttggaagacgcctacgacaagggccgcctgatgggc
acctttgccgaggactgcgcgctgcacaacggcttcacccgcgaggcccaggacgcgttt
gccatcgcgtccctgacccgtgcgcaagaggcgatctcccatggcaactttgccgccgag
atagtcccggtgcaggtcaccgtaggcaaagagcagaaaaccatcctgcatgacgaacaa
ccccccaaggccaagctggacaagatcagcagcctgaagccggcgttccgcgacggcggc
acagtgacggcggccaacgccagttcgatttccgatggtgcggcagccttgctgctgatg
cgccagtccgaggcccagaagcgcggcctcaagcccttggccgtgattcatgggcacgca
gcgtttgctgatgaaccgggattattcccggtggcgccggtgggcgctatccgcaagttg
atgaccaagaccggctggaacgtgggtgaagtcgatctgttcgagatcaacgaagccttt
gccgtggtcagcctggtgaccatgagcaagctggacatcccccacgccaaggtcaatatc
cacggcggcgcctgtgccctggggcatccgatcggtgcatcgggtgcgcggatcctggtg
acgctgctctcggccttgcgacagaacggcctcaagcgtggcgttgcagccatttgcatc
ggcggtggtgaagccacggccatggccgtcgaatgcctgtactaa

DBGET integrated database retrieval system