KEGG   Pseudomonas simiae PCL1751: PF1751_v1c50040Help
Entry
PF1751_v1c50040   CDS       T03766                                 

Gene name
apaG
Definition
(GenBank) ApaG protein
  KO
K06195  ApaG protein
Organism
pfw  Pseudomonas simiae PCL1751
Brite
KEGG Orthology (KO) [BR:pfw00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    PF1751_v1c50040 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 LuxE
Motif
Other DBs
NCBI-ProteinID: AJP54696
UniProt: A0A0W0HU50
Position
5545353..5545733
Genome map
AA seq 126 aa AA seqDB search
MSDPRYQIDVSVVTRFLADQSQPEQNRFAFAYTITVKNNGLVPAKLLSRHWVITDGDGQV
EEVRGAGVVGQQPLIDSGASHTYSSGTVMTSKVGTMQGSYQMKATDGQLFDAIIAPFRLA
VPGALH
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatcctcgctaccagatcgacgtcagcgtcgtcacccgcttcctggcggaccaa
tcccaacctgaacagaaccgctttgcctttgcctacaccatcacggtgaaaaacaacggg
ctggtgccggccaagctgctgtcgcgccactgggtgatcaccgacggtgacggtcaggtc
gaagaagttcgcggcgccggcgtggttggccagcaaccgttgatcgacagcggcgccagc
catacctatagcagcggcacggtgatgacctccaaagtcggcaccatgcagggctcctat
cagatgaaagccaccgacggccaattgttcgacgccatcatcgcgcctttccgcctcgcc
gtgccgggagccctgcactga

DBGET integrated database retrieval system