KEGG   Pseudomonas simiae PCL1751: PF1751_v1c50740Help
Entry
PF1751_v1c50740   CDS       T03766                                 

Gene name
fdhA
Definition
(GenBank) formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
pfw  Pseudomonas simiae PCL1751
Pathway
pfw00625  Chloroalkane and chloroalkene degradation
pfw00680  Methane metabolism
pfw01100  Metabolic pathways
pfw01120  Microbial metabolism in diverse environments
pfw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfw00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    PF1751_v1c50740 (fdhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PF1751_v1c50740 (fdhA)
Enzymes [BR:pfw01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     PF1751_v1c50740 (fdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C AdoHcyase_NAD Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AJP54766
UniProt: A0A5E7D9B2
Position
complement(5623639..5624838)
Genome map
AA seq 399 aa AA seqDB search
MSGNRGVVYLGSGKVEVQKIDYPKMQDPRGRKIEHGVILRVVSTNICGSDQHMVRGRTTA
QTGLVLGHEITGEVIEKGSDVENLKIGDLVSVPFNVACGRCRSCKEQHTGVCLTVNPARA
GGAYGYVDMGDWTGGQAEYVLVPYADFNLLKLPDRDKAMEKIRDLTCLSDILPTGYHGAV
TAGVGPGSTVYIAGAGPVGLAAAASARLLGAAVVIIGDVNSIRLAHAKGQGFEVVDLSTD
TPLHEQIAALLGEPEVDCAVDCVGFEARGHGHDGVKAEAPATVLNSLMGVVRVAGKIGIP
GLYVTEDPGAVDAAAKMGSLSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAIMWDRINIA
EIVGVQVISLDDAPRGYGEFDAGVPKKFVIDPHKLFSAA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtaatcgtggtgtcgtgtatctcggcagcggcaaggtcgaagtacagaaaatc
gactatcccaaaatgcaggacccccgtggcaggaagattgagcacggcgtcatcctgcgc
gtggtttccaccaacatctgcggctccgaccaacacatggtgcgcggccgcaccactgcc
cagaccggcctggtgctcggtcatgaaattaccggtgaagtgatcgagaagggcagcgac
gtcgagaacctgaaaatcggcgacctggtttccgtaccattcaacgtagcctgcggccgc
tgccgctcctgcaaagaacaacacaccggcgtgtgcctgaccgtcaacccggcccgtgcc
ggcggcgcctacggctatgtcgacatgggcgactggaccggcggccaggccgaatacgtg
ctggtgccctatgccgacttcaacctgctgaaactgccggaccgcgacaaggccatggag
aaaatccgcgacctgacgtgcctgtccgacattctcccgacgggctaccacggcgccgtc
acagcgggcgtgggcccaggcagcaccgtttacattgccggtgccggccctgtgggcttg
gccgctgcggcttcagcccgcctgttgggcgcagcggtggtgatcatcggcgacgtcaac
tccatccgcctggcgcacgccaagggccagggctttgaagtggtcgacttgtccaccgat
accccgctgcacgaacagatcgccgcgttgctcggcgagccggaagtggactgcgccgtc
gactgcgtaggttttgaagcccgcggccacggccacgacggcgtcaaggccgaagcaccg
gccaccgtgctcaattcattgatgggcgtggtgcgcgtggccggcaagatcggtatccct
ggcttgtacgtcaccgaagatccaggtgctgtcgatgccgccgcgaaaatgggcagcctg
agcattcgtttcggcctgggctgggccaaatcccacagcttccacactgggcagacgcca
gtgatgaagtacaaccgccagctgatgcaggcgatcatgtgggaccgtatcaacattgcc
gagatcgtcggcgtgcaggtgatcagcctggatgacgcgccacgtgggtatggcgagttt
gatgcgggtgtgccgaagaaatttgtgatcgatccgcataagttgttcagcgcggcataa

DBGET integrated database retrieval system