KEGG   Pseudomonas fluorescens L228: A7318_06140Help
Entry
A7318_06140       CDS       T04730                                 

Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
pfx  Pseudomonas fluorescens L228
Pathway
pfx00330  Arginine and proline metabolism
pfx00360  Phenylalanine metabolism
pfx00380  Tryptophan metabolism
pfx00627  Aminobenzoate degradation
pfx00643  Styrene degradation
pfx01100  Metabolic pathways
pfx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    A7318_06140
   00360 Phenylalanine metabolism
    A7318_06140
   00380 Tryptophan metabolism
    A7318_06140
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A7318_06140
   00643 Styrene degradation
    A7318_06140
Enzymes [BR:pfx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     A7318_06140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase RunxI
Motif
Other DBs
NCBI-ProteinID: AOE78183
Position
1392288..1393730
Genome map
AA seq 480 aa AA seqDB search
MSIVDWDATELSRAIHARQVSCEEVMQAYLAQIQRLNPGVNALVSLRDADDVMAEARARD
HELDQGRSRGWMHGMPQAIKDLAATQGLRTTLGSPLFAEHVPSEDAISVARVRASGAIII
GKSNVPEFGLGSQTYNTLFGTTGNAYDASLVAGGSSGGAAVALALRMLPVADGSDMMGSL
RNPAAFNNVFGLRPSQGRVPHGPMPELFVQQLGTEGPMGRSVTDVARLLSIQAGYDPRAP
LSSRDDPAIFGQPLQRDFKGVRVGWLGDYNGYLPMDDGVLSLCESSLGDFAALGCAVESC
QPDFSMARLWRSWLVHRHWLVHGNLGAAYANPKKRALLKPEAQWEVEGGLGLSAQQVYQA
SVDRSEWYRALAKLFERYDFLLLPTAQVFPFDARHAWPRLVGGREMDTYHRWMEVVIGPT
LAGLPSMSVPVGFNPQGMPMGMQIIGPAQADRAVLQLAYAHEQLTQWVQRRPPACLESMG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
ttgagtattgtcgattgggatgccaccgagctgtcgcgtgcgatccatgcacggcaggtg
tcgtgcgaagaagtgatgcaggcgtacctggcgcagatccagcgcttgaacccgggcgtg
aatgcgctggtgtcgctgcgtgatgccgacgacgtcatggctgaggctcgtgcgcgtgac
catgagttggaccagggccgctcacgtggttggatgcatggcatgccccaggcgatcaaa
gacctggcggccacccaaggtttgcgcaccaccttgggttcgccgctgttcgccgagcat
gtgccgagcgaagacgccatcagcgtggcgcgggtgcgggccagcggcgcgatcattatc
ggtaagagtaacgtgcccgaattcggcctgggctcgcagacctacaacaccctgttcggt
accaccggcaacgcctacgacgcaagcctggtggccggcggcagcagcggcggggcggcg
gtggccttggccctgcgtatgctgccggtggccgatggcagcgacatgatggggtcgttg
cgcaacccggcggcgttcaacaacgtgttcggcttgcgcccctcccaaggccgcgtgcct
cacgggcccatgcccgagctgttcgtgcagcaactgggcaccgaagggccgatgggccgc
agcgtgactgacgtggcgcggttgctgagcatccaggcgggttacgacccgcgggcgcca
ttatcgtccagggacgatcccgcgattttcggccagccgttgcagcgcgatttcaagggc
gtgcgcgtgggctggctgggggattacaacggctacctgccgatggacgacggtgtgctg
agcctgtgcgaatcgtccctcggcgatttcgctgcgctgggctgcgccgtggaaagctgc
cagccagacttctccatggcgcggctgtggcgcagttggttggtgcatcgtcactggctg
gtgcacggcaatctaggcgcggcctacgccaacccgaagaaacgcgcgctgctcaagccc
gaagcacaatgggaagtggagggtggcctgggcttgagtgcccagcaggtgtaccaggcg
tcagtggatcgcagcgagtggtaccgcgcgttggccaagctgttcgagcgttacgatttc
ctgttgttgcccaccgcccaagtgttccctttcgatgcacgacatgcgtggccgcgcctc
gttggcgggcgcgaaatggacacctatcaccgttggatggaggtggtgatcggcccgacc
ctggcggggctgccgagcatgagcgtgcccgtgggcttcaacccccagggcatgcccatg
ggcatgcaaatcatcggcccggcccaggcggaccgggcggtgctgcaattggcctacgcc
catgaacagctgacgcaatgggttcagcgtcggccgccggcgtgccttgaatcgatgggt
tga

DBGET integrated database retrieval system