KEGG   Pseudomonas lurida: A7318_06635Help
Entry
A7318_06635       CDS       T04730                                 

Definition
(GenBank) calcium-binding protein
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
pfx  Pseudomonas lurida
Pathway
pfx00053  Ascorbate and aldarate metabolism
pfx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    A7318_06635
Enzymes [BR:pfx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     A7318_06635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL DUF5122
Motif
Other DBs
NCBI-ProteinID: AOE78276
Position
1493699..1494577
Genome map
AA seq 292 aa AA seqDB search
MRIEVLVDVKTTLGEGPVWDVEQPRLYWIDSADGRILRCTDDGRELRAWEVGQKIGSMAL
RQAGESAIVALQNGVHTLDLDSGELDLVIDPEPHLPDNRLNDGKVDRQGRFIFGSMDTQE
DHASAKLYRLDADLSLHTLDEGIIVSNGPCWSPSGETFYFCDTWSGDIWAYDYDLATGHV
SNRRTFAKVDTAGGGAADGCTVDAEGCLWQALVYAGKLVRYTPDGQVDRIIQMPVKKVTS
LTFGGPNLDTLFVTSMAKPPLPRFPADGQQRGALFAITGLGVQGIAERRFAS
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatcgaagtgcttgtcgacgtcaagaccaccctaggcgaaggccccgtgtgggac
gtcgagcaaccacgcttgtattggatcgacagcgccgacggccgcatcctgcgctgcacc
gacgacggccgcgaactgcgtgcgtgggaggtgggccagaagatcggctccatggccctg
cgccaggcgggcgagtcggcgattgtcgcgctgcagaatggcgtgcacacgctcgacctc
gacagcggagagctcgacctggtcattgacccggaaccgcacctgcccgacaaccgcctc
aacgatggcaaggtcgaccgccagggccgcttcatcttcggctccatggacacgcaggaa
gaccacgccagcgccaagctctaccgcctggacgccgacttgagcctgcacaccctggac
gaaggcatcattgtgtccaacggcccgtgctggagcccgtcgggagagaccttctacttt
tgcgacacctggtccggcgatatctgggcctacgactatgacctcgccaccggccatgtg
agcaaccgccgcacctttgccaaggtcgataccgctggcggtggcgccgccgacggctgc
accgtggatgccgaaggctgcctgtggcaagccttggtctacgccggaaaactggtgcgc
tacaccccggatggccaggtcgaccgcatcatccagatgccggtgaaaaaggtcaccagc
ctgacgtttggcgggccaaacctggacaccctgtttgtgacttccatggccaagccgcca
ctgccgcgttttccggcggacggccagcagcgcggagcgctgttcgccattaccggtttg
ggcgtgcaaggaatagccgagcgacgattcgccagctag

DBGET integrated database retrieval system