KEGG   Pseudomonas lurida: A7318_06875Help
Entry
A7318_06875       CDS       T04730                                 

Definition
(GenBank) 23S rRNA (cytidine(2498)-2'-O)-methyltransferase RlmM
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
pfx  Pseudomonas lurida
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pfx03009]
    A7318_06875
Enzymes [BR:pfx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     A7318_06875
Ribosome biogenesis [BR:pfx03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    A7318_06875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ
Motif
Other DBs
NCBI-ProteinID: AOE78324
UniProt: A0A5E7R1E5
Position
1542987..1544063
Genome map
AA seq 358 aa AA seqDB search
MNTLFMHCRPGFEGEVCSEIAEHAARLNVSGYAKAKTGSACAEFVCTEEDGAQRLMHGQR
FAELIFPRQWARGVFIDLPETDRISVILAHLREFPVCGSLWLEMVDTNDGKELSNFCKKF
EVHLRKALLNAGKLVDDPSKPRLLLTFKSGREVFMGLAESNNSAMWPMGIPRLKFPREAP
SRSTLKLEEAWHHFIPRDQWDERLHGDMTGVDLGAAPGGWTWQLVNRGMLVTAIDNGPMA
ESLMDTGLVQHLMADGFTFVPKQPVDWMVCDIVEKPARNAALLETWIGEGHCREAVVNLK
LPMKQRYAEVKRLLERIEDGFKARGIRVEIGCKQLYHDREEVTCHLRRLETAKKPKAR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccctttttatgcactgccgcccgggttttgaaggcgaagtctgttccgagatc
gcggagcacgccgcgcgcctgaacgtttccggctacgccaaggccaagaccggcagcgcc
tgcgccgaattcgtctgcaccgaagaagacggcgcccagcgcctgatgcacggccagcgc
tttgccgagctgatcttcccgcggcaatgggcgcgcggggtattcatcgacctgccggaa
accgaccgcatcagcgtgattctcgcccatctgcgcgaattcccggtgtgcggcagcctg
tggctggagatggtcgacaccaacgacggcaaagaactctcgaacttctgcaagaagttc
gaagtgcacctgcgcaaagccctgctcaacgccggcaagctggtggacgacccgagcaag
ccgcggctgctgctcaccttcaagagtggccgcgaagtgttcatgggcctggccgagtcg
aacaactcggcaatgtggcccatggggatcccgcgtctcaagttccctcgcgaagcccct
agtcgctcgaccttgaagctggaagaggcctggcaccacttcatcccccgcgaccaatgg
gacgagcgcctgcatggtgacatgaccggcgtcgacctcggcgcggcaccgggcggctgg
acctggcagctggtcaaccgtggcatgctggtgaccgccatcgacaacggccccatggcc
gaaagcctgatggacaccggcctcgtgcaacacttgatggccgacggctttaccttcgtg
cccaagcagccggtggactggatggtctgcgacatcgtcgagaagccggcacgcaacgcc
gcgctgctggaaacctggatcggcgaggggcattgccgcgaggcggtggtgaacctgaaa
ttgccgatgaaacagcgttacgccgaagtgaagcggttgctggagcgtatagaggatggc
ttcaaggcgcgtggcattcgtgtggagatcggctgcaagcagctctaccacgaccgcgag
gaagtgacctgccatttgcgccgtttggaaacagcgaagaaacccaaggcccgctga

DBGET integrated database retrieval system