KEGG   Pseudomonas fluorescens L228: A7318_07565Help
Entry
A7318_07565       CDS       T04730                                 

Definition
(GenBank) 5'-nucleotidase
  KO
K01081  5'-nucleotidase [EC:3.1.3.5]
Organism
pfx  Pseudomonas fluorescens L228
Pathway
pfx00230  Purine metabolism
pfx00240  Pyrimidine metabolism
pfx00760  Nicotinate and nicotinamide metabolism
pfx01100  Metabolic pathways
pfx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A7318_07565
   00240 Pyrimidine metabolism
    A7318_07565
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    A7318_07565
Enzymes [BR:pfx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     A7318_07565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 5-nucleotidase
Motif
Other DBs
NCBI-ProteinID: AOE78456
UniProt: A0A2S8XHS6
Position
1695666..1696571
Genome map
AA seq 301 aa AA seqDB search
MAKGLGDKLVLAISSRALFDLSESHKVYLAEGVETYRQYQIEHEEEILAPGDAFPLVEKL
LSLNASLGRARVEVVLVSRNSADTGLRVFNSIQHYGLDISRAAFVGGRSPYPYLAAFGCH
LFLSTHAEDVRSALDAGFAAATILSGGPNRASSEELRIAFDGDAVLFSDESERVYQAGGL
EAFQANERESARQPLHGGPFKGFLAALNLLQREFADEACPIRTALVTARSAPSHERVIRT
LREWDIRLDESLFLGGLEKSAFLEAFAADVFFDDQAGHCEKAMEFVTTGHVPHGISNEVK
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagggcttgggcgacaaactggtgctggcgatttcctcgcgggcactctttgac
ttgagtgaaagccacaaggtctacctggccgaaggggtcgagacctatcgccagtaccag
atcgagcacgaggaggagatcctcgcgcccggcgacgcctttccgctggtcgagaagctg
ctcagcctcaatgccagcctcggccgtgcccgggtcgaagtggtgctggtgtcgcgcaac
agcgcggacaccggcctgcgcgtgttcaactcgatccagcattacggcctggatatttcc
cgcgccgcttttgtaggagggcgtagtccttatccttatttggcggcgtttggttgtcat
ctgtttttatcgacccacgctgaggatgtgcgcagtgccctcgatgccggctttgcggcg
gcgacgattctgtccggcggcccgaaccgtgcctccagcgaagagctgcgcattgccttc
gacggcgacgcggtgctgttttccgatgagtcggagcgggtgtaccaggccggtggcctg
gaagcgttccaggccaatgagcgcgagtcggcgcgtcagcctttgcacggcggtcctttc
aaagggtttctggcggcactcaatttgttgcagcgcgagttcgccgatgaggcctgcccg
atccgcaccgccctggtcactgctcgatcggcgccgtcgcacgagcgggtgattcgcacg
ttgcgtgagtgggatatccgcctggacgaatcattgttcctgggtggcctggaaaaatcc
gcgttcctggaggctttcgccgccgatgtatttttcgatgaccaggccggtcattgcgag
aaagccatggagtttgtcaccaccgggcatgtgccccatggcatcagtaatgaggtgaag
gtctaa

DBGET integrated database retrieval system