KEGG   Pseudomonas fluorescens L228: A7318_08920Help
Entry
A7318_08920       CDS       T04730                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
pfx  Pseudomonas fluorescens L228
Pathway
pfx00030  Pentose phosphate pathway
pfx01100  Metabolic pathways
pfx01120  Microbial metabolism in diverse environments
pfx01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A7318_08920
Enzymes [BR:pfx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     A7318_08920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Motif
Other DBs
NCBI-ProteinID: AOE78696
UniProt: A0A2S8XKF7
Position
complement(1976256..1977056)
Genome map
AA seq 266 aa AA seqDB search
MRISLEQQVALVTGASSGIGAGAAKALAQAGAAVVLNYNSQAAPAEALAAQINAEGGRAI
AIGADVSKEADVETLFAKTLDAFGHLDILVANSGMQKDANLVDMSLDDWNAVIGVNLTGQ
FLCARAAVRIFNRQGVRDGVSRAAGKIIHMSSVHQLIPWAGHVNYAASKGGVEMLMRTLA
QEVSQQRIRINGIAPGAIRTAINRAATEGAAEKELLKLIPYGRVGDVEDVANAVVWLASD
ASDYVVGSTLFIDGGMSLYPEFRGNG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatttcgttggagcaacaagtggccctggtgacaggcgccagttcgggaattggc
gcaggcgcggccaaggccctggcgcaggccggagcggccgtggtgctgaactacaacagc
caggccgcaccggccgaggccttggcagcgcagatcaacgccgagggtggccgcgcgatc
gccatcggcgccgacgtctccaaagaggccgatgtggaaacgctgtttgcaaagaccctg
gatgccttcggccacctggacatcctggtagccaactccgggatgcaaaaggacgccaac
ctggtcgacatgagcctcgacgactggaatgcggtgatcggcgtcaacctcaccggccag
ttcctgtgtgcccgcgcggccgtgcgtatcttcaatcggcaaggcgtgcgcgatggcgtg
tcgcgggcggcgggcaaaatcattcacatgagctcagtgcaccaattgatcccctgggcc
ggtcatgtgaattacgcggcgtccaagggcggcgttgagatgctgatgcgcaccctcgcc
caggaagtcagccaacagcgcatccgcatcaacggcattgcgccgggtgcgatccgtacg
gcgatcaaccgtgcggccaccgaaggtgcggcggaaaaagaactgctcaagctgattccc
tacggtcgcgtgggcgatgtggaagacgtggccaacgccgtggtgtggctggccagtgat
gcctccgactatgtggtaggcagcacgctttttattgacggcggcatgagcctttatccg
gagttccgtggcaatggttga

DBGET integrated database retrieval system