KEGG   Pseudomonas fluorescens L228: A7318_14585Help
Entry
A7318_14585       CDS       T04730                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pfx  Pseudomonas fluorescens L228
Pathway
pfx00071  Fatty acid degradation
pfx00072  Synthesis and degradation of ketone bodies
pfx00280  Valine, leucine and isoleucine degradation
pfx00310  Lysine degradation
pfx00362  Benzoate degradation
pfx00380  Tryptophan metabolism
pfx00620  Pyruvate metabolism
pfx00630  Glyoxylate and dicarboxylate metabolism
pfx00640  Propanoate metabolism
pfx00650  Butanoate metabolism
pfx00900  Terpenoid backbone biosynthesis
pfx01100  Metabolic pathways
pfx01110  Biosynthesis of secondary metabolites
pfx01120  Microbial metabolism in diverse environments
pfx01130  Biosynthesis of antibiotics
pfx01200  Carbon metabolism
pfx01212  Fatty acid metabolism
pfx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A7318_14585
   00630 Glyoxylate and dicarboxylate metabolism
    A7318_14585
   00640 Propanoate metabolism
    A7318_14585
   00650 Butanoate metabolism
    A7318_14585
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A7318_14585
   00072 Synthesis and degradation of ketone bodies
    A7318_14585
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A7318_14585
   00310 Lysine degradation
    A7318_14585
   00380 Tryptophan metabolism
    A7318_14585
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A7318_14585
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A7318_14585
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A7318_14585
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfx04147]
    A7318_14585
Enzymes [BR:pfx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A7318_14585
Exosome [BR:pfx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A7318_14585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOE79777
UniProt: A0A1B3DR60
Position
3278721..3280019
Genome map
AA seq 432 aa AA seqDB search
MSDYSFSPAPVRRVAIIGGNRIPFARSNTVYAHDSNQDLLVAALQGLVDRYNLHGQRLGE
FAAGAVIKHSRDFNLARESVLSTTLSPDTPAYDVQQACGTGLEAALLVANKIALGQIEVG
IAGGSDTTSDAPIGINESLRHTLLAANRAKGMGAKLQALLKVRPSMFFKPLLPRNGEPRT
GLSMGEHCEEMAKRWQIKRLAQDELTLTSHQRLDAAYKRGFFDDLISPHRGLARDNNLRA
DASLEKLAGLSPAYDRQNGTLTAGNSTPLTDGASVVLLASEEWAAEHGWPVLAYLRTGET
AAVNFVDGTEGLLMAPAYAVPRMLKREGLSFDDFDFFEIHEAFAAQALCTLKAWEDADYC
RERLGLDAPLGAIDRAKMNVNGGSLGCGHPFAATGGRQLAALAKIIHENGGGRGLISICA
AGGLGITAIVEK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgagtgactacagcttcagcccggccccggttcgccgcgtggcgatcatcggcggtaac
cgcatcccgttcgctcgctccaacaccgtgtacgcccacgacagcaaccaggatctgctg
gtggccgccctgcagggcctggtcgaccgctacaacctgcacggccaacgcctgggtgag
ttcgccgccggggcggtgatcaagcattcgcgggacttcaacctggcgcgtgagtcggtg
ttgtctaccactctgtccccggacacgccggcttacgatgtgcagcaagcgtgtggtact
ggcctggaagcggccttgctggtcgcgaacaagatcgccctgggtcagatcgaggtgggt
attgccggcggttccgacaccacctccgacgcgccgatcggcatcaatgaatccctgcgc
cacaccttgctcgcggctaatcgcgccaaaggcatgggcgccaagttgcaggcgctgctc
aaggtgcgaccgtcgatgtttttcaaacccttgctgccgcgcaatggtgagccgcgcacc
ggcttgtccatgggcgaacactgcgaagaaatggccaagcgctggcagatcaagcgcctg
gcccaggatgagctgaccctcaccagccatcaacgcctggacgcggcctacaaacgcggg
ttcttcgatgacctgatcagcccccatcgcggcctggcccgcgacaataacctgcgcgct
gacgcaagcctggagaaactcgccggcctgtccccagcctacgaccggcaaaacggtacg
ctcacggcgggcaattccacgccgctgaccgatggcgcgtcggtggtactgctggccagc
gaggaatgggccgccgaacatggctggccggtgctggcgtacctgcgcaccggcgaaaca
gcggcggtgaatttcgtcgacggcaccgaaggcttgctgatggccccggcctatgcggtg
ccgcgcatgctcaagcgcgaaggactgagcttcgatgactttgatttcttcgagatccac
gaagcctttgccgcccaggcgctgtgcacgctcaaggcctgggaagacgccgattattgc
cgcgagcgtctaggcttggacgcaccattgggggccatcgaccgcgcgaagatgaatgtc
aacggcggctcgctcggctgtggccatcccttcgccgccaccggtggccggcaactggcg
gcgctggccaagatcatccatgaaaacggcggcggccgcggccttatttctatctgcgcg
gccggcgggctgggcattaccgccatcgtcgaaaagtag

DBGET integrated database retrieval system