KEGG   Pseudomonas lurida: A7318_16415Help
Entry
A7318_16415       CDS       T04730                                 

Definition
(GenBank) cysteine--tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
pfx  Pseudomonas lurida
Pathway
pfx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A7318_16415
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pfx01007]
    A7318_16415
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pfx03016]
    A7318_16415
Enzymes [BR:pfx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     A7318_16415
Amino acid related enzymes [BR:pfx01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   A7318_16415
Transfer RNA biogenesis [BR:pfx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    A7318_16415
 Prokaryotic type
    A7318_16415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e DALR_2 tRNA-synt_1g tRNA-synt_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AOE80118
Position
complement(3652095..3653483)
Genome map
AA seq 462 aa AA seqDB search
MLTIYNTLSKTKEVFKPLDGNKVRMYVCGMTVYDYCHIGHGRSMVAFDLVTRWLRFSGYD
LTYVRNITDIDDKIINRANENGESFDALTERMIAAMHEDEARLNILKPDMEPRATDHIPG
MHAMIQALIDKGYAYAPGNGDVYYRVAKFMGYGKLSRKKIEDLRIGARIEVDEAKQDPLD
FVLWKGTKPGEPSWESPWGAGRPGWHIECSVMSTCCLGDTFDIHGGGSDLEFPHHENEIA
QSEAATGKTYANAWMHCGMIRINGEKMSKSLNNFFTIRDVLAKYHPEVVRYLLVSSHYRS
AINYSEDNLKDAKGALERFYHALKGLPSVAPAGGEAFVARFTEVMNDDFGTPEACAVLFE
MVREINRLRESDLDAAAGLAARLKELASVLGVLQMEADDFLQAGAEGRVDAAEVDALIQA
RLAARANKDWAESDRIRDQLTAMGVVLEDGKGGTTWRLADQA
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
gtgctaacgatctacaacacgctgagcaaaaccaaagaagtcttcaagccgctggatggc
aacaaggtgcgcatgtacgtgtgcggcatgaccgtgtacgactactgccacatcggccac
ggccgcagcatggttgccttcgacctggtgacccgctggttgcgtttcagcggctatgac
ttgacctatgtgcgcaacatcaccgacatcgacgacaagatcatcaaccgcgccaatgaa
aacggcgagtcgttcgacgcgctgaccgagcgcatgatcgccgcgatgcacgaggacgag
gcgcgcctcaacatcctcaagccggacatggaaccgcgtgccacggaccacatccctggc
atgcacgcgatgattcaggccctgatcgacaagggttatgcctacgccccgggcaatggc
gacgtgtactaccgcgttgccaagttcatgggctacggcaagctgtcgcgcaagaaaatc
gaagacctgcgcatcggcgcacgcatcgaagtcgatgaagccaagcaggacccgctcgac
ttcgtgctgtggaaaggcaccaagcccggcgagccaagctgggagtcgccatggggcgcc
gggcgtccgggctggcacatcgaatgctcggtgatgtccacctgctgcctgggtgacacc
ttcgacattcatggcggcggcagcgaccttgagttcccgcaccacgaaaacgaaatcgcc
cagagcgaagccgccaccggcaagacctacgccaatgcctggatgcactgcggcatgatc
cgcatcaatggcgagaagatgtccaagtccttgaacaacttcttcaccatccgcgacgtg
ctggcaaagtaccatccggaagtggtgcgttacctgctggtgtcgagccactaccgcagc
gccatcaactactcggaagacaacctcaaggacgccaagggcgccctggagcggttctac
catgcgttgaaaggcttgccatccgtggcacctgcaggcggcgaagcgttcgttgcgcgc
ttcaccgaggtcatgaacgacgacttcggcaccccggaagcctgcgccgtgctgttcgaa
atggtgcgcgaaatcaaccgcctgcgtgagagcgacctcgacgcagcggcgggcctggca
gcgcgcttgaaagaactggcgagcgtactgggcgtgttgcagatggaagccgatgacttc
ctgcaagccggcgccgaagggcgtgtggatgcggctgaagtggacgcgctgatccaggcg
cgtttggctgcgcgtgccaataaagactgggcggaatccgaccgtatccgtgaccaactg
accgcgatgggtgtggtgttggaagacggcaagggtgggaccacgtggcggttggctgat
caggcctga

DBGET integrated database retrieval system