KEGG   Pseudomonas lurida: A7318_21510Help
Entry
A7318_21510       CDS       T04730                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pfx  Pseudomonas lurida
Pathway
pfx00480  Glutathione metabolism
pfx00590  Arachidonic acid metabolism
pfx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    A7318_21510
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A7318_21510
Enzymes [BR:pfx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     A7318_21510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA AHJR-like
Motif
Other DBs
NCBI-ProteinID: AOE81065
Position
4746775..4747257
Genome map
AA seq 160 aa AA seqDB search
MSAFHDLKLKALDGQDLPLAPFKGQVVLVVNVASKCGLTPQYAALENLYQQYKDQGFTVL
GLPCNQFAGQEPGTEEEIQSFCSLNYGVTFPLGSKLEVNGPDRHQLYRLLAGEGAEFPGD
ITWNFEKFLLGKDGRVLARFSPRTPPDDPSVVQAIEKALA
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctttccacgacctgaaactcaaagctttggacggacaagacctgccactggcg
cccttcaaggggcaagtggtgctggtagtcaacgtggcctccaaatgtggtttgaccccg
caatatgccgcgctggaaaacctctaccagcagtacaaggaccagggatttaccgtgctc
ggcctgccgtgcaaccagtttgcagggcaggagccaggtaccgaggaagagatccagtcg
ttctgcagcctgaactacggcgtgacgttcccgttgggcagcaagcttgaggtcaacggt
cctgatcgtcatcagctgtaccgcctgctggcgggtgagggcgccgagtttcctggggat
atcacctggaacttcgagaaattcctgctgggtaaggatggccgggtactcgcgcgcttt
tctccgcgtacgccgcccgatgatccgtcggtggtccaggccatcgaaaaagccctggcc
tga

DBGET integrated database retrieval system