KEGG   Pseudomonas lurida: A7318_23565Help
Entry
A7318_23565       CDS       T04730                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pfx  Pseudomonas lurida
Pathway
pfx03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A7318_23565
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pfx03011]
    A7318_23565
Ribosome [BR:pfx03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A7318_23565
  Bacteria
    A7318_23565
  Archaea
    A7318_23565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AOE81454
UniProt: E2RXQ3
Position
5204611..5204943
Genome map
AA seq 110 aa AA seqDB search
MEVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSSKKAAEIMKKVLESAVANAEH
NEGADVDDLKVSTVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKVADK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagccgctaagttgtcgggcgctcgaatctccgcccagaaagcccgcttggtc
gccgaccagatccgcgggaagaaggtgggcgaagcgctcaacctgttggctttcagcagt
aagaaagccgccgagatcatgaagaaagtgctggagtcggccgtagccaacgccgagcat
aacgaaggcgcagacgttgatgacctgaaagtcagcaccgttttcgtcaacgaagggcgt
tcgctgaagcgcatcatgccacgtgccaaaggccgtgctgatcgcatcgtcaagcggtct
tgccatatcactgtcaaggttgctgacaagtaa

DBGET integrated database retrieval system