KEGG   Pseudomonas lurida: A7318_23925Help
Entry
A7318_23925       CDS       T04730                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone-4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
pfx  Pseudomonas lurida
Pathway
pfx00740  Riboflavin metabolism
pfx00790  Folate biosynthesis
pfx01100  Metabolic pathways
pfx01110  Biosynthesis of secondary metabolites
Module
pfx_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    A7318_23925
   00790 Folate biosynthesis
    A7318_23925
Enzymes [BR:pfx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     A7318_23925
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     A7318_23925
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 Lip_A_acyltrans
Motif
Other DBs
NCBI-ProteinID: AOE81524
UniProt: A0A5E6TCM4
Position
5284999..5286090
Genome map
AA seq 363 aa AA seqDB search
MALNSIEELVEDIRQGKMVILMDDEDRENEGDIIMAAEACQAEHINFMAKYARGLICMPM
SRERCELLKLPLMAPRNGSGFGTKFTVSIEATTGVTTGISAADRARTVQAAAAKDAKAED
IVSPGHIFPLMAQPGGTLARAGHTEAACDLARMAGFEPSGVICEVMNDDGTMARRAELEA
FAAEHNIKVGTIADLIHYRMIHERTVQRIAEQPLDSELGQFNLVTYRDSVEGDVHMALTL
GAICAEEPTLVRVHNMDPLRDLLMVKQPGRWSLRAAMAAVSAAGSGVVLLLGHPLDGDVL
LAHIRETADHVPVKKPTTYSIVGAGSQILRDLGVRKMRLMSAPMKFNAISGFDLEVVEYV
PSE
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtggcgctcaatagcatcgaagaactggttgaagacatccgccaaggcaagatggtcatc
ctgatggatgacgaagaccgcgagaacgaaggcgacatcatcatggccgccgaggcctgc
caggctgagcacatcaacttcatggccaagtacgcccgcgggctgatctgcatgcccatg
agccgtgaacgctgcgaattgctcaagctgccgttgatggcgccgcgcaatggctcgggt
tttggcaccaagttcaccgtgtccatcgaagccaccacgggcgtcaccaccgggatctcc
gccgctgaccgcgcgcgcaccgtgcaagcggctgcggcgaaagatgccaaggccgaagac
attgtcagccccggtcacatcttcccgctgatggcccaaccgggcggcaccctggctcgc
gccggccataccgaagctgcctgcgacctggcgcgcatggccggtttcgagccgagcggc
gtcatctgcgaagtcatgaatgacgacggcaccatggcccgtcgcgccgaactcgaagcc
tttgccgccgaacacaacatcaaggtgggcaccattgccgacctgattcactaccgcatg
atccacgaacgtaccgttcagcggattgccgagcagccactggacagcgaactgggccaa
ttcaatctggtgacctaccgtgattcagtggaaggtgacgtgcacatggccctgaccctg
ggggccatttgcgccgaagagccgaccctggtgcgtgtgcacaacatggacccgctgcgc
gacctgctgatggtcaagcaacccggccgctggagcctgcgcgccgcgatggctgcggtc
tccgcggcaggcagtggtgtggtgctgttgctcggccacccgttggatggcgatgtgctg
ctggcgcatattcgcgaaacggctgatcacgtgccggtgaaaaaaccgactacctacagc
atcgtgggtgccggttcgcagatcctgcgtgacctgggcgtgcgtaaaatgcgcctgatg
agtgcaccgatgaaatttaatgcgatatccggtttcgacctggaagtagtagaatacgtg
ccctccgaataa

DBGET integrated database retrieval system