KEGG   Pseudomonas lurida: A7318_24995Help
Entry
A7318_24995       CDS       T04730                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pfx  Pseudomonas lurida
Pathway
pfx00260  Glycine, serine and threonine metabolism
pfx01100  Metabolic pathways
pfx01110  Biosynthesis of secondary metabolites
pfx01120  Microbial metabolism in diverse environments
pfx01130  Biosynthesis of antibiotics
pfx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    A7318_24995
Enzymes [BR:pfx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     A7318_24995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AOE81727
Position
5513232..5514272
Genome map
AA seq 346 aa AA seqDB search
MTDKSQQFASDNYSGICPEAWAAMEQANQGHQRAYGDDEWTHRAADGFRNLFETDCEVFF
AFNGTAANSLALSSLCQSYHSVICSETAHVETDECGAPEFFSNGSKLLTARTENGKLTPE
SIREIALKRQDIHYPKPRVVTLTQATEVGSVYTPEEIRAISVTCKELGLNLHMDGARFSN
ACAFLGCSPADLTWKAGVDVLCFGGTKNGMAVGEAILFFNHKLAEDFDYRCKQAGQLASK
MRFLSAPWVGLLENDAWLKHARHANHCAQLLSSLVADIPGVELMFPVQANGVFLQLSEPA
IAALTDKGWRFYTFIGKGGARFMCAWDTEEERVRELAADIRKVMEA
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacaagagccaacaattcgccagtgacaactattccggcatctgcccggaagcc
tgggccgccatggaacaagccaaccagggccatcagcgcgcctacggcgatgatgaatgg
acccaccgcgccgccgacggtttccgcaacctgttcgaaaccgactgcgaagtgttcttc
gccttcaacggcactgccgccaactccctggcgctgtcctcgctgtgccagagctaccat
agcgtgatttgctcggaaaccgcccacgtcgaaaccgacgaatgtggtgcgccggagttt
ttctccaacggctccaagctgctcaccgcccgcaccgaaaacggcaagctgaccccggag
tcgatccgcgagatcgcactcaagcgccaggacatccactaccccaagccgcgcgtggtc
accctgacccaagccactgaagtcggcagcgtgtacaccccggaagaaatccgcgccatc
agcgtgacctgcaaggagctggggctgaacctgcacatggacggcgcacgcttctccaac
gcgtgcgcgttcctgggttgctcgcccgcggacctgacctggaaagccggcgtggacgtg
ctgtgctttggcggcaccaagaacggcatggccgtgggcgaagcgatcctgttcttcaac
cacaagttagccgaagacttcgactaccgctgcaaacaggcgggccagctggcgtcgaaa
atgcgcttcctgtctgcgccatgggtgggcctgctggaaaacgatgcctggctcaagcac
gcacgccacgccaaccactgcgcgcagctgctgagcagcctggtggcggatattcccggc
gtggagttgatgttcccggtgcaagccaacggcgtgttcctgcaactctcggaaccggcc
atcgcagcgctgaccgacaaggggtggcgtttctacaccttcatcggcaaaggcggcgcg
cgcttcatgtgtgcgtgggataccgaggaagagcgtgtaagagaactggcagcggatatt
cggaaagtgatggaggcctga

DBGET integrated database retrieval system