KEGG   Pseudomonas lurida: A7318_25205Help
Entry
A7318_25205       CDS       T04730                                 

Definition
(GenBank) fructose-1,6-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
pfx  Pseudomonas lurida
Pathway
pfx00010  Glycolysis / Gluconeogenesis
pfx00030  Pentose phosphate pathway
pfx00051  Fructose and mannose metabolism
pfx00680  Methane metabolism
pfx01100  Metabolic pathways
pfx01110  Biosynthesis of secondary metabolites
pfx01120  Microbial metabolism in diverse environments
pfx01130  Biosynthesis of antibiotics
pfx01200  Carbon metabolism
pfx01230  Biosynthesis of amino acids
Module
pfx_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A7318_25205
   00030 Pentose phosphate pathway
    A7318_25205
   00051 Fructose and mannose metabolism
    A7318_25205
  09102 Energy metabolism
   00680 Methane metabolism
    A7318_25205
Enzymes [BR:pfx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     A7318_25205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase DUF285
Motif
Other DBs
NCBI-ProteinID: AOE81768
UniProt: A0A0D0SZ16
Position
complement(5564088..5565152)
Genome map
AA seq 354 aa AA seqDB search
MALISMRQMLDHAAEFGYGVPAFNVNNLEQMRAIMEAADKTDSPVIVQASAGARKYAGAP
FLRHLILAAIEEFPHIPVCMHQDHGTSPDVCQRSIQLGFSSVMMDGSLGEDGKTPTDYEY
NVRVTQQTVAMAHACGVSVEGELGCLGSLETGMAGEEDGIGAEGVLDHSQMLTDPEEAAD
FVKKTQVDALAIAIGTSHGAYKFTKPPTGDVLAIDRIKEIHKRIPNTHLVMHGSSSVPQE
WLAIINQYGGDIKETYGVPVEEIVEGIKYGVRKVNIDTDLRLASTGAMRRLMATNPSEFD
PRKFFGATVTAMRDVCIARYEAFGTAGNASKIKPISLEAMYQRYLKGELNAKVN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcacttatcagcatgcgtcaaatgctggaccacgcagccgagttcggctacggcgtc
ccagcctttaacgtcaacaaccttgagcagatgcgcgccatcatggaagccgctgacaag
accgactcccccgtgatcgtccaggcctcggccggtgcacgcaaatacgccggtgccccg
ttcctgcgtcatctgatcctcgccgcgatcgaagaattcccgcacatcccggtgtgcatg
caccaggatcacggcaccagccctgacgtgtgccagcgctccatccaactgggcttcagc
tcggtgatgatggacggttccctcggcgaagacggcaagaccccgaccgactacgaatac
aacgtccgtgtgacccaacagaccgtggccatggctcacgcctgcggcgtttcggttgaa
ggcgagctgggctgcctgggttcactggaaaccggcatggccggcgaagaagacggcatc
ggtgccgaaggcgtgctggatcacagccagatgctgaccgacccggaagaagccgctgac
ttcgtgaagaagacccaagtggatgccctggccatcgccatcggcaccagccacggcgcc
tacaagttcaccaagccgcctaccggcgacgtgctggctatcgaccgcatcaaggaaatc
cacaagcgcatccccaatacccacctggtgatgcacggttcttcctcggtcccgcaagag
tggctggcgatcattaaccagtacggcggcgacatcaaggaaacctacggcgtaccggtt
gaagaaatcgtcgagggcatcaagtacggcgtgcgcaaggtcaacatcgataccgacctg
cgcctggcgtccaccggtgcgatgcgtcgcctgatggccaccaacccgagcgaattcgac
ccgcgtaagttcttcggcgcgaccgtgaccgcgatgcgcgatgtgtgtatcgcacgttat
gaagcgttcggtactgccggtaatgcttcgaagatcaagccgatctccctggaagcgatg
tatcagcgttacctgaaaggtgagttgaacgccaaggtgaactga

DBGET integrated database retrieval system