KEGG   Pseudomonas fluorescens L228: A7318_27930Help
Entry
A7318_27930       CDS       T04730                                 

Definition
(GenBank) acetyl-CoA hydrolase
  KO
K18118  succinyl-CoA:acetate CoA-transferase [EC:2.8.3.18]
Organism
pfx  Pseudomonas fluorescens L228
Pathway
pfx00020  Citrate cycle (TCA cycle)
pfx00620  Pyruvate metabolism
pfx00650  Butanoate metabolism
pfx01100  Metabolic pathways
pfx01110  Biosynthesis of secondary metabolites
pfx01120  Microbial metabolism in diverse environments
pfx01130  Biosynthesis of antibiotics
pfx01200  Carbon metabolism
Module
pfx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pfx_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A7318_27930
   00620 Pyruvate metabolism
    A7318_27930
   00650 Butanoate metabolism
    A7318_27930
Enzymes [BR:pfx01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.18  succinyl-CoA:acetate CoA-transferase
     A7318_27930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetylCoA_hyd_C AcetylCoA_hydro CoA_trans CitF LUD_dom
Motif
Other DBs
NCBI-ProteinID: AOE82291
Position
complement(6164704..6166197)
Genome map
AA seq 497 aa AA seqDB search
MYRDRIRLPSLLNKVMSAADAAALIEDGMTVGMSGFTRAGEAKAVPHALAERAKTSPLKI
TLMTGASLGNDLDKQLTEAGVLSRRMPFQVDSTLRKAINAGKVMFIDQHLSETVEQLRNN
QLKLPDIAVIEAVAITEQGHIVPTTSVGNSASFAIFAKQVIVEINLAHNPNLEGLHDIYI
PTYRPTRTPIPLVKVDDRIGSTAIPIPPEKIVAIVITNQADSASTVTPPDSDTQGIANHL
INFLKQEVDAGRMTNKLGPLQAGIGNIANAVMCGLIESPFEDLTMYSEVLQDSTFDLIDA
GKLSFASGSSITLSERRNADVFGNLEHYKDKLVLRPQEISNHPEVVRRLGIIGINTALEF
DIYGNVNSTHVCGTRMMNGIGGSGDFARNAHLAIFVTKSIAKGGAISSVVPMVSHVDHTE
HDVDILVTEVGLADLRGLAPRERARVIIDNCVHPAYRDALNSYFNAACAIGGHTPHILRE
ALSWHINLEETGHMLKA
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgtgatcgcatccgcttgccttcgttgttgaacaaggtcatgagcgcggcagac
gccgctgcactgattgaagacggcatgaccgttggcatgagcggcttcacccgcgccggt
gaagccaaggccgtaccccacgccctggccgaacgcgccaagacgtccccgctgaaaatc
accctgatgaccggcgccagcctgggcaatgacctggacaagcaactgaccgaagccggc
gtgctgtcccgacgcatgccgttccaggtcgacagcactctgcgcaaagcgatcaacgcc
ggcaaggtgatgtttatcgaccaacacctgtcggaaaccgtcgagcaactgcgcaacaac
cagctcaagttgccggatatcgcagtgattgaagcagtcgcgatcactgaacaaggccat
atcgtgcccaccacttcagtgggcaactccgccagcttcgcgattttcgccaagcaggta
atcgttgagatcaacctggctcacaacccgaacctggaagggctgcacgacatctatatc
ccgacctatcggccgacgcgcacgccaatacccctggtgaaagtcgacgaccgtatcggt
agcaccgccattccgatccccccggaaaaaatcgtcgccatcgtcatcaccaaccaggcc
gactccgcctccaccgtgacgccgcccgatagcgacacgcaaggcattgccaaccacctg
atcaacttcctcaagcaggaggtcgacgctggccgcatgaccaacaagctcggcccgctg
caggccgggatcggcaacatcgccaacgcagtgatgtgcgggctgatcgagtcgccgttc
gaagacctaaccatgtattcggaagtgttgcaggattcaaccttcgacctgatcgacgcg
ggcaagctgagcttcgcgtcgggcagttcgatcaccttgtcggaacggcgcaacgccgac
gtgtttggcaacctggaacactataaggacaagctggtcttgcgcccgcaggagatctcc
aaccacccggaagtagtgcgtcgcctgggcatcatcggcatcaacactgcgctggagttc
gacatctacggcaacgtcaactccacccatgtctgcggcacgcggatgatgaacggtatt
ggcggctccggggatttcgcacgcaatgcgcacctggcgatcttcgttaccaagtcgatt
gccaagggcggggcgatttcaagcgtggtgcccatggtcagccatgtggaccacaccgaa
catgacgttgacatcctagtgaccgaagtcgggctggccgacctgcggggcctggcacca
agggaacgagcccgcgtgatcatcgacaactgtgtgcatcccgcgtaccgcgatgcgctg
aacagttacttcaacgccgcttgcgccatcggcgggcataccccccacatcctgcgcgaa
gcactgagttggcacattaacctggaagaaacagggcatatgctcaaggcgtga

DBGET integrated database retrieval system