KEGG   Pestalotiopsis fici: PFICI_00505Help
Entry
PFICI_00505       CDS       T04924                                 

Definition
(RefSeq) Exoglucanase 1
  KO
K01225  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00500  Starch and sucrose metabolism
pfy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PFICI_00505
Enzymes [BR:pfy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     PFICI_00505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_7
Motif
Other DBs
NCBI-GeneID: 19265518
NCBI-ProteinID: XP_007827277
UniProt: W3XMG1
Position
Unknown
AA seq 456 aa AA seqDB search
MQVHSKIAAASALIAAVKAQSACTLTTETHPSMSWSNCDASGSCTTTAGSVTVDANWRWT
HTVDGSTNCYSGNEWDAALCPDAETCTANCCLDGAEYSNTYGVTTSGNAMSLTFVTDGQY
STNIGSRLYLMADDSTYQGFTLLGNEFTFDVDVSKLGCGLNGAVYFVSMDLDGGSSAFPS
NTAGAKYGTGYCDSQCPSDVKFIDGVANSDGWEPSSNDENAGTGSKGACCAEMDIWEANS
ISTAYTPHPCTNSAYHSCEGDACGGTYSSDRYAGDCDPDGCDFNSYRQGNETFYGPGSSF
TLDTTQKLTIVTQFLTDDSGSLSEIKRFYVQDGVVIPNSESSIGGVTGNSITTDYCTAQK
TAFGDQDIFAKRGGLAQMGAALAEPMVLVMSLWDDHAANMLWLDSTYPVDSTADGAARGT
CATTSGVPSDVEANQASSTVTYSNIKFGPIGSTFAR
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttcactccaagatcgcggccgcctcggccctcattgctgccgtcaaggcgcag
tcagcttgcacactgaccactgagactcacccttctatgagctggtccaactgtgacgct
tcgggctcttgcacaaccaccgctggttccgtgaccgtcgatgccaactggcgatggacg
cacacagtcgatggctcgaccaactgctacagcggcaacgagtgggacgctgccctctgc
cctgacgccgagacatgcactgccaactgctgcttggacggtgccgagtactcgaatacc
tatggtgtcaccacgagcggtaatgctatgagcctcacttttgttaccgatggccagtac
agcaccaacattggtagccgtctctacctcatggcagacgattcaacttaccagggcttt
actcttcttggaaatgagtttacttttgatgttgacgtctccaagctcggatgcggcttg
aacggtgccgtctactttgtgtccatggacttggacggtggttccagcgctttcccatcc
aacactgctggtgccaagtacggaactggttactgtgactcgcagtgccccagtgatgtc
aagttcattgacggagttgccaactctgatggctgggaaccttcatccaacgacgaaaac
gccggaactggttccaagggtgcttgctgtgctgagatggatatctgggaggccaacagc
atctcgactgcctacactccccacccctgcaccaacagcgcctaccactcgtgcgagggc
gacgcctgcggtggaacctactcctccgaccgatacgccggtgactgcgaccctgatggc
tgcgacttcaacagctaccgccagggcaacgagaccttttacggtcccggctcgagcttc
accctcgacacgacccagaagctcaccattgtcacccagttcctgactgacgactctggt
tccctgagcgagatcaagcgcttctacgtccaggacggcgtcgtcatccccaactccgag
tcgagcatcggtggcgtcaccggaaactccatcaccaccgactactgtactgctcagaag
acggcctttggcgaccaggacattttcgccaagcgcggtggactggcccagatgggtgcc
gccctcgccgagcccatggtcctggtcatgtctctctgggacgaccacgccgccaacatg
ctctggctcgactctacctaccccgttgactccaccgccgacggtgctgctcgtggtacc
tgcgccaccacctcgggtgtccccagcgatgtcgaggccaaccaggcctcttcgaccgtc
acctactccaacatcaagtttggccccattggctcgacttttgcgaggtga

DBGET integrated database retrieval system