KEGG   Pestalotiopsis fici: PFICI_01711Help
Entry
PFICI_01711       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00010  Glycolysis / Gluconeogenesis
pfy00053  Ascorbate and aldarate metabolism
pfy00071  Fatty acid degradation
pfy00280  Valine, leucine and isoleucine degradation
pfy00310  Lysine degradation
pfy00330  Arginine and proline metabolism
pfy00340  Histidine metabolism
pfy00380  Tryptophan metabolism
pfy00410  beta-Alanine metabolism
pfy00561  Glycerolipid metabolism
pfy00620  Pyruvate metabolism
pfy01100  Metabolic pathways
pfy01110  Biosynthesis of secondary metabolites
pfy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PFICI_01711
   00053 Ascorbate and aldarate metabolism
    PFICI_01711
   00620 Pyruvate metabolism
    PFICI_01711
  09103 Lipid metabolism
   00071 Fatty acid degradation
    PFICI_01711
   00561 Glycerolipid metabolism
    PFICI_01711
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PFICI_01711
   00310 Lysine degradation
    PFICI_01711
   00330 Arginine and proline metabolism
    PFICI_01711
   00340 Histidine metabolism
    PFICI_01711
   00380 Tryptophan metabolism
    PFICI_01711
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PFICI_01711
Enzymes [BR:pfy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     PFICI_01711
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-GeneID: 19266724
NCBI-ProteinID: XP_007828483
UniProt: W3XP98
Position
Unknown
AA seq 492 aa AA seqDB search
MASVTLTGAEGRSITVPTGLFIDNKFEPATSGATIDVENPSTGKHLATVSAAQAEDVDRA
VQSAKKAYVSWKKVDSGEKRRLLNRLADLVERDAVELASLEALESGVLYGVSRALHVQES
ISNLRYFAGWADKLDGDSLSIPQGLAYTRREPIGVCAAIVPWNSLMIAFWKIAPALATGN
VLILKTPEITPLWGCKLAQLIAEAEIPPGVVNIITGLGNIAGQALSEHNDIKKISFTGSP
GVGRRILETSAKTNLKKVSLELGGKGPSIVFADADLENALFWTTLGITVSNGQVCAAGSR
IYVQDTIYEKFVEEFSKRSRDAVHGDPLLPETTKGSVANKAQLDKILEYVKKGKESGARL
LHGGERLPGDGYFIANTAFAEVDQKAPIMQEEVFGPLASIAPFSTLDEIIAKANDTSYGL
SAAVFTNDVNKAFRLSEEIESGMVTVNAWGMIHANTPFGGVKESGFGRDMGKEALEDWTT
TKTVKWNILPTK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgttactttgactggtgccgagggccgtagcataacagttccgacgggcctc
ttcattgacaacaagtttgaacccgcaaccagcggcgccacgattgacgtggaaaatccg
agcaccgggaagcacctagccaccgtctccgccgcccaggcagaagatgtcgaccgtgcc
gtacagtcggccaagaaggcctatgtgagctggaaaaaggttgactctggagagaaaaga
agattactcaacagactggccgatctggtcgagcgagacgccgtggaactggcatcgcta
gaggccctcgagagtggagtgctgtatggagtatccagggctctccacgttcaggagtca
atcagcaaccttcgctactttgccggctgggctgataagcttgacggcgactccctcagc
atcccgcagggactggcctacacgcgacgggaacccatcggcgtctgcgccgccatcgtg
ccttggaactcactgatgattgcgttctggaagattgcccctgccctcgctactggcaat
gtgctcatcctcaagactcccgaaatcacccctctctggggctgcaagctggctcagctg
attgccgaggcagagatcccgcctggcgttgtgaacatcatcactggcctgggcaacatt
gctggccaggcgctgtccgagcacaatgacattaagaagatatcatttaccggaagcccc
ggcgtgggcagacgaatcttggagacgtcggccaagaccaacctcaagaaggtgtctctg
gagcttggcggcaagggtcccagcattgtattcgccgatgcagacctcgaaaacgccttg
ttctggaccacgctgggtatcacagtcagcaacggccaggtttgtgctgcgggcagccgc
atctatgttcaggataccatttatgaaaagtttgtggaagagttcagcaagcggagcaga
gatgccgtccacggcgacccactgcttccagagaccaccaagggatctgttgccaacaag
gcccaactggacaagatacttgagtatgtcaagaagggcaaagagtcgggcgccagactc
ctgcacggcggcgagcggctgccaggagacggctactttatcgcaaatacggcctttgcc
gaggttgaccaaaaggcccccattatgcaagaagaggtgtttggcccgctggccagtatt
gctcctttcagcacactagatgagatcattgccaaggccaatgataccagctacggtctg
agcgctgccgtctttaccaatgacgtgaacaaggcctttaggctcagcgaggagatcgag
tcgggcatggtcacggtcaatgcttggggcatgattcatgccaacacaccatttggaggc
gtaaaggagagtggctttggaagggatatgggtaaagaggccctcgaggactggacgact
accaagacggtcaagtggaacattctacccaccaagtaa

DBGET integrated database retrieval system