KEGG   Pestalotiopsis fici: PFICI_04641Help
Entry
PFICI_04641       CDS       T04924                                 

Definition
(RefSeq) Homoserine O-acetyltransferase
  KO
K00641  homoserine O-acetyltransferase/O-succinyltransferase [EC:2.3.1.31 2.3.1.46]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00270  Cysteine and methionine metabolism
pfy00920  Sulfur metabolism
pfy01100  Metabolic pathways
pfy01110  Biosynthesis of secondary metabolites
pfy01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    PFICI_04641
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PFICI_04641
Enzymes [BR:pfy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     PFICI_04641
    2.3.1.46  homoserine O-succinyltransferase
     PFICI_04641
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Say1_Mug180 Abhydrolase_4
Motif
Other DBs
NCBI-GeneID: 19269654
NCBI-ProteinID: XP_007831413
UniProt: W3X9N7
Position
Unknown
AA seq 490 aa AA seqDB search
MAAENGATSKPSYERSRQQPENPFAALIPDQEIAIIPSFTLESGVTLQNVPLAYTTRGKL
SPNRDNAMVICHALTGSADVSDWWGPLLGGPGRAFDTSRFFVICMNSLGSPYGTASPVTA
KDGNPDNERYGPEFPLTTIRDDVNLHKLLLDDLGVRQVAAVIGGSMGGMLVLEWAYFGKD
YVRCIVPIATSSRHSAWCISWGEAQRQSIYADPKYDDGYYTLEDQPVTGLGAARMSALLT
YRSRNSFEARFGRNIPDPAKRQTITENPRSTTPSETHFHIHNDGHKVTRSSVSRSSSFAS
QTKAEAAKPGEAPVAVASADPQFSGPKESLTGGDRPPTTTYFSAQSYLRYQGQKFVKRFD
SNCYIAITRKLDTHDVSRYRADSVPEALALIEQPTLVLGIESDGLFTFAEQQEIAQHVKN
SRLKEIVSQEGHDAFLLQFEQVNKYILDFLQEVLPDIMEKEGDVVEAASVGQMTKSSVFG
EAEVEDITAW
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgaaaacggtgctactagcaaacccagctacgaaagatcgcggcaacagccc
gaaaatccgttcgcagccttgattccagaccaggagattgccattatcccttctttcacg
ttggagtcgggcgtcactctccaaaatgtgccacttgcctacaccactcggggcaaactg
tccccaaatcgtgacaatgccatggtcatatgccatgccttgacgggaagtgccgatgtc
agtgattggtggggacctctcctaggtggtcctgggcgagcctttgatacctcgaggttc
ttcgttatctgcatgaacagcttgggaagcccgtacggcactgccagtcctgtgactgcc
aaggacggcaaccctgacaatgagagatatggtcctgagttcccattgaccacgattcga
gacgatgtcaatctgcacaaactgctgcttgatgatctaggtgttcgtcaggtcgccgcc
gttataggtggttctatgggcggaatgctcgttcttgagtgggcatatttcggcaaggac
tatgttcgttgcatcgtgccgatcgcaacgtcgagtcgtcacagtgcttggtgcattagt
tggggcgaggcccagcgtcagagcatttacgctgaccccaagtacgacgatggctactat
accctcgaagatcagccagtcacgggtctcggcgcggctcgcatgtccgcactgctcacc
taccgaagcagaaactcctttgaggcgcgtttcggccgcaacatccccgacccagcaaaa
aggcaaaccattacagaaaacccaaggtccaccacaccatctgagactcacttccacatc
cacaatgatgggcacaaggtgactagatcttctgtgtcgcgctctagtagctttgcaagc
caaacgaaagcagaggcagccaagcccggcgaagcacctgtcgcagtcgcatcagcggat
ccgcaattttcgggtcccaaggagagcttgacgggtggcgataggccccccactacgaca
tacttttctgcacagtcatatctgcgctaccaaggacagaaattcgtcaagcgattcgac
agcaactgttacattgccatcacgcgcaagctcgacactcacgatgtctctcgttaccgc
gcggactccgtccccgaggccctggcgctcattgaacagcccacgctcgttcttggtatc
gaaagtgatgggctgttcacattcgcggagcagcaggagattgcacagcacgtcaagaac
tccagattgaaggaaattgttagtcaggaaggccacgatgctttcctgctgcaattcgag
caggtgaacaagtatattctggatttcctccaagaggttctccctgacatcatggagaag
gaaggcgatgttgtagaagctgcttctgtgggacagatgaccaagtctagtgtgttcggc
gaagcagaggttgaagacattacagcttggtag

DBGET integrated database retrieval system