KEGG   Pestalotiopsis fici: PFICI_05093Help
Entry
PFICI_05093       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00430  Taurine and hypotaurine metabolism
pfy00460  Cyanoamino acid metabolism
pfy00480  Glutathione metabolism
pfy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    PFICI_05093
   00460 Cyanoamino acid metabolism
    PFICI_05093
   00480 Glutathione metabolism
    PFICI_05093
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pfy01002]
    PFICI_05093
Enzymes [BR:pfy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     PFICI_05093
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     PFICI_05093
Peptidases and inhibitors [BR:pfy01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   PFICI_05093
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 19270106
NCBI-ProteinID: XP_007831865
UniProt: W3XCS6
Position
Unknown
AA seq 613 aa AA seqDB search
MAEYTARAIFPDDNNHYVRYPSRRSVVHGTNGLVACTQPLAAEVGQRVLKMGGNAADAAV
AVAAAMNMTEPASTGIGGDMFCLYFDNTTKRVHALNGSGRSPAGATLEQVKKEVGEGNGR
IPINSALSVTVPGAAAGWVDAVEAFGSGKLTLEQILMPAIEMGERGFPVSEFSASMWRNA
EKKLKMASPNFREMLKPDAAAEDGCRAPRAGEIFRNPALANIFRKLAKEGKHGFYSGDIS
HAIIETLREKGSRMELSDLQEHMVRGTSETQPISLRFRGQNVKKNASKKLSGDLLDDHFV
EIWEHPPNGQGIVALMALGILEELEAGGDVPAFRPEDHNSPAYLHAIIEVLRIAFADANW
WVTDPDLSGVSAEDMTSRLYLAQRAKLFDKTKAGIFSRGDLGSSPAQNHSDTVYFAVTDR
DGNAMSFINSNFREFGSCIIPKGCGFTLQNRGSGFVLEPEHHPNVYAPAKRPYHTIIPGL
VTHGVGDNRQLHSVYGVMGGLMQPQGHVQVLLNMEVFGMNPQQALDAPRICIAAGPPGAE
DPTLSTIFFEEGIDDTVISALEEMGHRVKKMEGWNRFWFGRGQVIRRHVDEETAQVVYSG
GSDPRGDGCVLMA
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggctgaatacactgccagggccattttccctgatgacaacaaccactatgtgcgatat
ccaagtcggaggagcgtggtccatggcacaaatggtcttgttgcatgtacacaaccactc
gctgcagaggtcgggcaaagggtcttgaagatgggaggcaatgctgctgatgccgccgtg
gccgtggctgctgccatgaatatgacggagcctgcctctacgggaatcggaggtgacatg
ttctgtctctacttcgataacacgaccaagagagtacacgctcttaatggctccggacgc
agtcctgcaggtgcaacgcttgagcaagtcaagaaagaggtcggcgagggcaatggcaga
atccccatcaacagtgctctctccgtcactgttccaggtgctgctgctggctgggtcgat
gctgttgaggcctttggtagtggcaagttgactttggaacagatcctcatgccagctatt
gagatgggcgaacgaggatttcccgtaagcgagttctcagcaagtatgtggcggaatgca
gagaagaaactaaaaatggcatcgcctaatttccgtgagatgctgaagccggatgctgca
gctgaagacggatgtcgtgcgccgcgtgctggagaaatctttcgaaacccagctcttgcc
aatatattcaggaagctggcaaaagaagggaaacacggtttctattctggagatatctca
catgcaattatcgaaactctcagggaaaagggcagtcgaatggagttatctgatctccaa
gaacacatggtccgcgggaccagcgagacgcaacccatttcgttgcgatttcgcggccag
aatgtgaagaagaatgcttcaaagaaactgtcaggcgacttattggacgatcatttcgtc
gagatttgggagcatccgcccaatggacaaggaatcgtcgccttgatggctctgggaatc
ctcgaggagctggaggcggggggcgacgtgccagcttttcgccccgaggaccacaacagt
cccgcctatctgcacgctattatcgaagtcttgaggatcgccttcgcagatgccaactgg
tgggtgactgatcccgacttgagtggcgtctcggccgaagatatgacgtcgcgtctttac
ctagcacaacgtgccaaactctttgacaagaccaaggccgggatattctccaggggcgac
ctggggtccagtccagcgcaaaatcatagcgacacggtttattttgctgtgactgatcga
gatggaaacgccatgagctttatcaactccaactttcgagagtttggatcctgtataatt
ccaaagggctgcggctttacccttcaaaacaggggctctgggtttgtgctcgagcccgag
catcacccaaatgtctacgctccagcaaagcggccatatcataccatcattccaggcctg
gtaacccacggcgttggagacaatcgtcagttgcactcagtttacggtgtcatgggaggt
ttaatgcaaccacaaggccatgttcaggttttgctgaacatggaggtctttggcatgaac
ccgcaacaagctttggatgcgccgaggatatgcattgcggctgggccaccaggtgctgaa
gatccaacgctctcaaccatcttcttcgaagaagggatagacgataccgtcatttcagca
ctggaggaaatgggacatcgcgtcaagaagatggagggctggaatcgattctggtttggt
cgtggccaggtgattcgaagacacgttgacgaagagacggcccaggttgtatacagtggc
ggaagtgaccctcgaggtgatggttgtgttctaatggcataa

DBGET integrated database retrieval system