KEGG   Pestalotiopsis fici: PFICI_06391Help
Entry
PFICI_06391       CDS       T04924                                 

Definition
(RefSeq) Geranylgeranyl pyrophosphate synthase
  KO
K00804  geranylgeranyl diphosphate synthase, type III [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00900  Terpenoid backbone biosynthesis
pfy01100  Metabolic pathways
pfy01110  Biosynthesis of secondary metabolites
pfy01130  Biosynthesis of antibiotics
Module
pfy_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PFICI_06391
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:pfy01006]
    PFICI_06391
Enzymes [BR:pfy01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     PFICI_06391
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     PFICI_06391
    2.5.1.29  geranylgeranyl diphosphate synthase
     PFICI_06391
Prenyltransferases [BR:pfy01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   PFICI_06391
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-GeneID: 19271404
NCBI-ProteinID: XP_007833163
UniProt: W3X5T7
Position
Unknown
AA seq 399 aa AA seqDB search
MLSTKPSEPPFPYPSPNAIPPRTFSTGYAVPHPPSKSALRPLPESNWLSQGKHHRHTSST
TSAAAIRTQPLTAVVMSPSAPPPDPSKYATEDFNFTARKTWTDQKEQIIWGPYDYVTSQP
GKDFRTLLIASFNSWLEVPEESIEVINKVVGMLHNASLLVDDVEDNSTLRRGLPVAHMIF
GTAQTINSANYIYFAALQELQKLKNPKVVTIYMDELINLHRGQGMDLFWRDTLTCPTEED
YLEMVGNKTGGLFRLGVKLMQAESKSLVDCVELVNLMGLIYQIRDDYMNLSSVEYSNNKG
LCEDLTEGKFSFPVIHSIRSDPANLQLLNILKQKTTDEGVKRYAVKYMEGTGSFEYTLQV
LDVLIQRARKTADELDNGMGKNKGIHKILDKMVVSPATA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgctctccaccaaacccagcgaacctccttttccctacccgtcgccgaacgccatacct
cctcgaaccttctcgaccggatacgctgtgcctcatcctccctccaagtctgcgctgcgt
cctctgccagagtccaactggctgagccaaggaaaacatcatcgtcacacctcttccact
acctcggccgctgctatccggacacaacctctcactgccgtagtcatgtctccctcggcg
cctcctccggacccctccaagtacgcgactgaagacttcaactttactgcaagaaagacg
tggacggaccagaaggaacagattatatggggaccctacgactacgtaacgagccaaccc
ggaaaggactttagaacactgctcattgcttccttcaacagctggctggaggttcccgag
gaaagcattgaagtcatcaacaaggttgtgggcatgttacataatgcgtctctacttgtc
gacgacgtggaggacaattctaccctccgtcgcggcctgcctgtagcgcacatgatcttt
ggcacggcacagaccattaattcggccaactacatctactttgctgctctccaggagctg
caaaagctcaagaaccccaaggtcgtcacaatatacatggacgagctcatcaacctgcac
aggggacagggtatggatcttttctggcgcgataccctgacctgcccgaccgaggaggac
tatctcgaaatggtcggtaacaagactggcgggctcttcaggttgggtgtaaagctcatg
caggctgagtcaaaatcgctggtagactgtgtcgagcttgtaaacctcatgggcctcata
tatcaaatccgcgacgactatatgaatttgtcgtctgtggagtacagtaataacaagggc
ctatgcgaggacctgaccgagggaaaattctcgttccccgttatacactccattcgatcc
gatcccgcgaaccttcagctcttgaacattctcaagcagaagacgacggacgagggcgtc
aagcgttatgcggtcaaatacatggagggtaccggtagttttgaatacacactacaagtt
ctcgacgttctcattcagagagcgaggaagactgccgacgaactcgataacggcatgggc
aagaataagggaattcacaagatcctggacaagatggtcgtctcgccagccactgcctaa

DBGET integrated database retrieval system