KEGG   Pestalotiopsis fici: PFICI_08107Help
Entry
PFICI_08107       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
  KO
K07359  calcium/calmodulin-dependent protein kinase kinase 2 [EC:2.7.11.17]
Organism
pfy  Pestalotiopsis fici
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pfy01001]
    PFICI_08107
Enzymes [BR:pfy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     PFICI_08107
Protein kinases [BR:pfy01001]
 Serine/threonine kinases: Other
  CAMKK family
   PFICI_08107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 19273120
NCBI-ProteinID: XP_007834879
UniProt: W3X362
Position
Unknown
AA seq 699 aa AA seqDB search
MDEATHMVYNVGKTFAKKARSAPAVQQYHSPMRQHKRTPSQHREVKETLNAISEYTSDDP
DGTKLRINQYVIKEEIGRGSYGAVHLATDQFGNEYAMKEFSKSRLRKRAQSNILKRPGGL
RPGRGMRSPWSAHKRELSEHDAAEAKDSLFFIREEIAIMKKLNHPNLVSLIEVLDDPEED
SLWMVLEMCKKGVVMKVGLDSDAEAYSAEQCRHWFRDLILGIEYLHAQGIIHRDIKPDNL
LLTEDDCLKIVDFGVSEMFEKSADMRTAKSAGSPAFLPPELCMARHGDISGKAADIWSMG
ISLYCLKFGRLPFHRDNVLEMYDSIRTEELPIPSDEDPNLSDLLRRILQKDPEQRITMAE
MRNHPWVTKDGEDPLLSEGENITELVEPPNELEVNHALTRKMSHMLTVMIAINKFKGLIY
KSRVGTPDLKASHRMSRTLEVPRAAEIELPQESSKHSSPANSGNTTPTAEEPQQENRPRN
KSNAEEAAELVKARKAYLASNGHPARSGAPDVKGQTQNSSEGAPAFLGIGLGDHDEFAGS
ETPADFVSDSPTGIDFNVYDRAFEAEMERIRSEKRGPRRTTYLTKLVNEKEKYFGDDCMI
LEAGRSLPALASSGYNKASSAAVRTLGHMGLAHREGAGAGEESSKTEHLRQALEAKKLES
RDSVQAVKERGHKFAELVMGTMASAKAKATGEAKEQKDS
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggacgaggcgacgcacatggtttataatgtcggcaagacttttgctaagaaagccaga
tcagcacctgccgttcagcaataccatagccccatgaggcagcacaagaggacgccaagt
caacatcgcgaagtcaaggaaactctcaatgccatttccgagtacaccagcgatgatcca
gacgggacaaaactcaggatcaatcaatatgtcatcaaggaggagattggcagaggatct
tatggagccgtgcatctggccacagatcagtttggcaatgaatatgccatgaaggagttt
tccaaaagtcgattgcggaaacgagcgcaatccaacattctgaagcgacctggtggcctc
agacccggacgagggatgcggtcgccatggtctgcacacaaaagggaacttagtgagcac
gatgctgccgaggcaaaagattctctctttttcatccgggaagaaattgccatcatgaaa
aagctgaatcacccaaacctggtgtccttgatcgaggtcctcgacgatcccgaagaggat
tcgctttggatggttcttgagatgtgtaaaaagggcgtcgtcatgaaggttggcctagac
agcgacgccgaagcctatagtgcagaacagtgcagacattggtttcgcgacttgattttg
ggcattgaatacttacatgcacaaggtattatacatcgtgatatcaaaccggacaacctt
cttttgacggaagacgactgcctcaagatcgtggactttggagtatcggaaatgtttgaa
aagtctgccgacatgaggacagccaaatctgccggttcgccagccttccttcctcctgag
ttgtgcatggccaggcacggcgatatatcaggaaaggccgcggatatatggtccatgggc
atttcattatactgtctcaagtttggcagactgcctttccatcgtgacaacgttctagaa
atgtacgattctattcgcacagaagagcttcctattccatccgacgaggatccgaacctc
tcagacctcctgcggcggatcctccaaaaggacccggagcagaggatcaccatggcagag
atgaggaatcatccttgggtcaccaaagatggcgaggaccctcttctatctgaaggggag
aacattaccgaactcgtagagccaccaaacgagcttgaagtcaatcatgcgttgacacgt
aagatgagtcatatgttgactgttatgatagccatcaacaaattcaaagggctcatttac
aagagccgcgttggaacccctgacctcaaagcatcgcatcggatgtcgaggacgttggaa
gtgcctagagcagctgagatagaactgcctcaagaatcttcgaaacattcctcgccagca
aactctggtaacacaactccgactgcagaagaaccgcagcaggagaatcgacctcggaac
aaatccaacgccgaagaggccgccgagttggtgaaagcacgcaaagcctatcttgcctca
aacggtcatcctgcccgaagcggagcacccgacgtgaagggccaaacccaaaattccagc
gaaggagcgcccgcctttttgggaatcggcctcggcgaccacgatgaatttgcaggttcg
gaaacgcctgcggatttcgtgtctgattcgccgaccgggattgatttcaacgtgtacgac
cgtgcattcgaggcagaaatggagcgtattcgttctgagaaacgtgggcctcgtcggaca
acatatctcaccaagcttgtcaacgagaaggaaaagtactttggcgatgattgcatgatc
cttgaggcgggtcgcagtctaccggctcttgcatcttccggctacaacaaggctagctcg
gcagcagtcaggacattgggtcatatgggtttggcacaccgcgagggtgccggtgctggc
gaggagagctccaagactgagcatctcagacaagcactcgaagcgaaaaagctcgaaagt
cgtgactcagttcaggctgtcaaggaaaggggacacaaattcgcagagctcgtcatgggt
acaatggcgagtgccaaggccaaagcaacgggagaggccaaggagcagaaagattcctag

DBGET integrated database retrieval system