KEGG   Pestalotiopsis fici: PFICI_08632Help
Entry
PFICI_08632       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
pfy  Pestalotiopsis fici
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PFICI_08632
Enzymes [BR:pfy01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     PFICI_08632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox NAD_binding_8 FAD_binding_2 NAD_binding_7 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 19273645
NCBI-ProteinID: XP_007835404
UniProt: W3WYD4
Position
Unknown
AA seq 421 aa AA seqDB search
MAKKSVAIIGSGWAGFTLSQKLSLAKYDVTVISPVRTIQYTPLLASAACGLFNFRLAEEP
VRRKHRTDLKYFKAIAEAIDFEKRTISCKSTAVTGDSEDGKTFNVNYDKLIIAPGCDIQT
FGTPGADKHALFLRTTNDARLIQQRILEILDKASLPGISDEEQRGLLSIRIVGGGAIGME
AAAEIYDLWSEDMRFLFPHLDGKLTITIHDVAPQILSTFDSKLSEYATKSLQGRHIELKT
SSHIQNVESDAIFTKEDGRLPYGVLLWATGNKACSLVEKLNVKKPEKGLPRIITDKYLRV
LHPDGSPMEDVYALGDAADIEGESLPTLAEVALQKGEYLSKTLNQDDTGSIKPFEYQQRA
LLAYLGQHDGVIGGKEDWSGPAAWIAWRSGSLGWTRSWRRRLMIMISWLFVWIGGRDIAR
P
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaaatctgtagccatcatcggctccggctgggccggctttactctttcacag
aagctgtcgctggcaaaatacgacgtgaccgtcatttcaccagtccgcacgattcagtat
acgccgctactggccagcgcggcatgcggtctcttcaactttcgtctcgccgaggagcca
gtccgccgcaaacaccggacagatctgaagtacttcaaggccattgcggaagccattgac
tttgaaaagcggacgatcagctgtaaatcgacagccgtgacgggggacagcgaggatggc
aaaacattcaacgtgaactatgacaagctgatcatcgcgcccggctgcgacattcagact
tttggcacgccgggggccgacaaacacgccctctttctgcgcacgaccaacgacgcgcgg
ctcatccagcagcgcatcctcgagatcctcgacaaggcctcgctgccgggcatcagcgac
gaggagcagcggggcctcttgagcatccgcatcgtgggcggcggcgccattggcatggag
gccgcggccgagatctacgacctctggagcgaggacatgcggttcctcttcccgcacctc
gacggcaagctgaccatcaccatccacgacgtggcgccgcagattctgtccacgtttgac
tccaagcttagcgagtacgccaccaagtcgttgcaaggccggcatatcgagctcaagacg
agctcgcacattcagaatgtcgagtccgacgccatttttaccaaggaggatggcaggctg
ccttatggagtcctgctgtgggctactggcaacaaggcgtgttccttggtggagaaactt
aatgtcaaaaagccagagaaggggctgcccaggatcattacggacaagtacctgcgtgtt
ctgcacccggatggcagcccaatggaggatgtgtatgcgctaggtgatgcggcagacatt
gagggagaatctctgccaacgcttgccgaggtggcgctgcagaagggagagtacttgtca
aaaaccctgaatcaggacgacactggatcgatcaagcctttcgagtatcaacagcgtgct
ctgttggcttacctgggtcagcacgacggagtcattggtggcaaggaagactggagcggt
cccgcagcgtggatcgcctggagatctggcagtttgggatggactcgtagctggaggagg
agactaatgatcatgataagttggttgtttgtatggattggtgggcgagatattgcacga
ccttga

DBGET integrated database retrieval system