KEGG   Pestalotiopsis fici: PFICI_09012Help
Entry
PFICI_09012       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00052  Galactose metabolism
pfy00500  Starch and sucrose metabolism
pfy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    PFICI_09012
   00500 Starch and sucrose metabolism
    PFICI_09012
Enzymes [BR:pfy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     PFICI_09012
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32C Glyco_hydro_32N
Motif
Other DBs
NCBI-GeneID: 19274025
NCBI-ProteinID: XP_007835784
UniProt: W3WZE1
Position
Unknown
AA seq 613 aa AA seqDB search
MWSLVFFAAGALGQAGIDYNSAPPNLSTLANGSLFETWRPRAHILPPFGQIGDPCAHYVD
AETGTVHFGWLHDGASGATTDDLVTYKDLNADGAPFIEAGGLNDPVAVFDGTVINVGVDG
KPTFLYTSVSYLPIQWTIAYTRGSETQSLAVSYDDGKNFTKLEQGPVIPGPPFAVNVTGF
RDPYAFQSTQLDTLLNSTDGTWYLVISGGVHGDGPSQFLYRQYDPEFQYWEELGQWWHEV
ANTTWGSGNWAGRWGFNFEVSNIFTLDEEGYSDDGAFFTTLGAEWSLAPIVPQVSDFRDA
LWVSGDVTIEDGEVKFIPSYAGKLEWGHSAYATHGQVVRADSKPSNASGAPDRFISTTWL
TGDYYGTLDPATNQQNWTGALLLPRELSIGKICNVVDNELAREVGSWKTSRNESGVVDLS
TLRQTIVRESLAALLEGESFQEDSRTLNSSAVIPFQQSPQSKFFVLEASITVPQSVRGGD
VKAGFQILASEYESTSIYYQFSNESIMVDRANTSAAAETTNDIDSRNEYGRLRLFDIAQD
GEATVEVLKLTIVVDNAVVEIHANDRFVLSTWARSWYASSTELRFFHEGEGEVTFENITI
HEGLFDAWPDRAY
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtggtccctcgtcttctttgctgccggagcactcggccaggcaggtatagactacaat
tccgcgcctcccaacctgtccacactcgccaatggttctctattcgagacttggcggcct
cgcgctcacatactgcctccctttggacagattggagacccctgcgcccactatgtagat
gccgagacgggcactgtccatttcggctggcttcacgatggtgcttcgggggcgaccacg
gatgaccttgtcacatacaaggacttgaatgcagatggcgcccccttcatcgaggcggga
ggactgaatgatccggtggccgtattcgacggcaccgtcatcaacgtgggcgtggacgga
aaaccaacgtttctatacacctccgtttcgtatttgcccatccagtggaccattgcttat
actcgtggaagcgagacacagtctctcgctgtatcctatgacgacggcaagaactttacc
aagctggagcaagggccagttatcccaggacctccctttgccgttaacgtgacaggattt
cgggatccctacgcctttcaaagcacacagctcgatacactcctcaacagcactgacggt
acgtggtaccttgtcatctcgggaggcgtacacggcgacggtccaagtcagttcctttac
cgccagtatgaccccgagttccagtactgggaggagcttggccaatggtggcacgaggtc
gccaacacgacatggggaagtggcaactgggcgggccgttggggcttcaactttgaggta
tccaacatcttcacactggacgaagaaggctacagtgatgacggagcattcttcaccacc
ctgggagccgagtggtcactagcacccattgtgccccaagtgtctgatttcagggacgcg
ctgtgggtctcgggtgacgtgacaatcgaggacggcgaggtcaaattcattccttcatat
gcgggaaagttggaatggggacactcggcctatgcgacccatggacaggttgtccgagca
gactcgaagccgtccaatgcgagcggcgctccggatcggttcatctctaccacgtggctc
actggagactactatggcaccttggacccggctaccaaccagcagaattggaccggcgcc
cttcttttgccccgagagctcagcatcggaaagatttgcaacgttgtggacaatgaactc
gctcgagaggtcggatcatggaaaacaagccgaaatgagtcgggcgttgtggacctttcc
acccttaggcaaaccattgtgagagagtcgcttgcagccctcttggagggtgagagcttc
caggaagacagccgtactctgaactcttccgccgtgataccattccaacaatctccccaa
tccaaattctttgtcctcgaggcctcgatcactgtcccgcagtcagtccggggcggtgat
gtcaaggcaggattccagatactcgcttccgagtatgagagcacaagtatctactaccag
ttcagcaacgagtccatcatggttgaccgagccaacaccagtgctgccgccgagactacc
aatgacattgactcccggaatgaatatggacggctccgtcttttcgatattgcgcaagat
ggcgaggcgacagtagaagtactcaaattgactattgtggttgataacgcagtggtcgaa
attcacgccaatgatcgattcgttttgagcacgtgggcacgctcttggtatgcctcatca
actgaacttcgcttctttcatgaaggagagggcgaagtcacgttcgagaacataacaatt
cacgagggcttgtttgatgcctggccggaccgcgcctactaa

DBGET integrated database retrieval system