KEGG   Pestalotiopsis fici: PFICI_10199
Entry
PFICI_10199       CDS       T04924                                 

Definition
(RefSeq) Delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00100  Steroid biosynthesis
pfy01100  Metabolic pathways
pfy01110  Biosynthesis of secondary metabolites
Module
pfy_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    PFICI_10199
Enzymes [BR:pfy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     PFICI_10199
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 19275212
NCBI-ProteinID: XP_007836971
UniProt: W3WYC7
Position
Unknown
AA seq 479 aa
MTSLRPKYEFGGPLGAAAIVLGLPVLLFVFHLTCNDVSGCPIPSLLSPTTFTWEDFTAQT
PWPRDGFQSLFSWEATGWLLAYYLVSMTLHRVLPAQEVYGSKLRDSGLPLKYRFNAFSAT
VIQLSLCAIGTYFRGADFIVWTYVTDNYLQLLTSSTILAFGISMFVYVLSFQVKPGNSNL
RELARGGRTGNFVYDFYIGRELNPRLTLPFFGEIDLKTWLEMRPGLTGWIILDLAFVAKQ
YRDYGYLSDSIILTSTLQAYYVLESHYLEANILSMMDIIADGLGFMLTFGDIVWVPFLYS
TQCRYLATYPLHLGYVNLTAFGAIFTIGAYIFRASNDQKNLFRSNPNHPSVSGITYLQTK
RGTRLLTGGWWGISRHMNYLGDWLHTLPFCLPTLMAGYLILPAGTPTDTVSIEMLDGKQV
VQGDAKGWGMVYTYFYAIYFAVLLVHRENRDDVACAEKYGKDWDRYKEIVRWRIVPGLY
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgacatccctccgacctaaatatgagtttgggggcccgctcggcgctgccgccatagtt
ctgggacttcctgtgctgctcttcgtctttcatctcacgtgcaacgacgtgagcggttgc
cccatccccagtctattgagcccgacgacatttacctgggaagacttcacggcccaaacg
ccctggcctcgggatggattccaatcactgttctcttgggaggccactggatggcttctg
gcatactacctagtcagtatgactttacaccgagttctccccgcccaggaagtgtatggc
tccaaattgcgcgattccggcctgcctctcaagtaccgcttcaatgcattctccgccact
gtcatccaattatccctctgtgccattggtacctactttcgtggtgcagacttcattgta
tggacatatgttacggataactacctccaactcctcacatccagtacaattcttgccttt
ggcatctccatgtttgtttatgtgttgagcttccaggtgaagcctggcaacagcaatctt
cgggaactcgcccgagggggccgcaccggcaatttcgtctatgatttctacattgggcgc
gaactcaaccctcggcttacacttcccttctttggtgaaatcgacctaaagacctggttg
gaaatgcgccctggactgactggctggattatacttgatctagcctttgtcgccaaacaa
taccgcgactatggatacttgtctgatagcataatacttacgtccaccctgcaagcatac
tatgtgcttgagtcgcattatctagaggccaacatcttgagcatgatggacataattgca
gacggtttggggttcatgctgacctttggcgacattgtctgggtaccattcctctattcc
acacagtgccgttatcttgcgacgtatcccctccacctcggatatgtcaaccttacggct
tttggtgcgatattcaccatcggcgcatacatcttccgcgcctcaaatgaccaaaagaat
ctcttccgcagcaaccccaaccatccaagtgtctctggaattacttatctacagaccaag
cgaggtaccaggcttctcactggcgggtggtgggggatctcgcgccatatgaactacctg
ggcgactggctgcacactttgccgttctgcttgccaaccctaatggctggctatctcatc
ctgccagctggaacgccaacggataccgtgagcatcgagatgctggatggaaagcaagtg
gtgcagggcgacgcaaaaggttggggcatggtatatacctacttctatgcgatctacttt
gctgtgcttctcgtgcaccgagagaacagagacgatgtcgcctgtgctgagaagtacgga
aaagactgggacagatacaaggagattgttcgctggagaatcgtgccaggtctgtactag

DBGET integrated database retrieval system