KEGG   Pestalotiopsis fici: PFICI_10610Help
Entry
PFICI_10610       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
  KO
K17100  dihydroxyacetone synthase [EC:2.2.1.3]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00680  Methane metabolism
pfy01100  Metabolic pathways
pfy01200  Carbon metabolism
Module
pfy_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    PFICI_10610
Enzymes [BR:pfy01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.3  formaldehyde transketolase
     PFICI_10610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N TPP_enzyme_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 19275623
NCBI-ProteinID: XP_007837382
UniProt: W3WXE7
Position
Unknown
AA seq 716 aa AA seqDB search
MPSVAPWLSNEGATTASPGEVNGVDNAKLKGWRAELDDDDYAVLALRNFIFDICDQNGGG
HGGSAIGMAAIGVALYKYTMRYNPSNSDWFDRDRFVLSNGHCAMFLYALNHLTGFDNWTM
DEIRGYGSAKLGDYKTICHAHPEIEVPGVEVTTGPLGQGIANAVGLAIASKNLAARFNRP
GFDLVSSRIYCMSGDGCLMEGVALEAISLAGNLQLDNLVILYDNNQVTCDGPLDWINTED
VNAKMRACGWHVLEVADGNYDVQAVTTALAHAQSLRGKPVFINIRTVIGVGTQVAGTHKA
HHGTFDKESVQLSKQLAGQDPNLTHVIPEKPLKYFRDCKAKGESLESKWNDLLGEYSTKH
PDLAADFRQAVSGDYGTKWLDILKATDSAQFKGTATRDVNGSLIEAIWKDFPALCGGGAD
LVNSNKVHYTESDVFHPSVSYAGRYVRYGIREHAMAAISNGLAAYNPGTFRPVTATFLIF
FLYAAPGIRMGALSHLPVIHFATHDSFAEGQNGPTHQPVELDSLFRAMPNLSYMRPCDAE
ETIGAWMLALGKTSGPSMLSLGRDPTGPVPSTDRYKVAKGAYVVVDQTNSKLTLASCGTN
LHYAVAAAELLTSEGLPTRVVSCPSFEHFDQQDQQYRDSVFPKDGSPIVSVEEYVATTWA
RYVTASIGMQSYGFSASNPSNYARFGLDSEGIIRRTKQYLKDMEGKNARMEGWRQI
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcggtagcaccatggctcagtaatgaaggcgccacaactgccagccccggcgaa
gtcaatggagtggacaatgccaagctcaaaggttggagagcagagctcgacgacgacgac
tatgcagttcttgcgctgcgaaacttcatttttgacatttgtgatcaaaacggcggtgga
catggcggctctgccatcggtatggctgccattggagtcgctctctacaagtacaccatg
cgatacaatccgtctaattcggattggttcgatcgcgatcgttttgtgctttcaaatggt
cactgcgccatgtttctatatgcattgaatcatctgacgggctttgacaactggaccatg
gacgaaatcaggggctatggaagtgcaaagctgggcgactacaagacaatttgccatgca
catcccgagattgaagttccgggagtagaggttacgaccgggcctcttggccagggaatt
gcgaatgcagttggcttagccattgcctccaaaaacctggctgctagattcaaccgccct
ggcttcgacctcgtttcctccaggatatactgcatgagtggtgatggatgtctcatggag
ggtgtggcattggaagcaatctctttggccggaaatctgcaattggacaatctcgtcata
ctctacgacaacaaccaggtcacgtgtgacgggcccttggactggatcaataccgaagat
gtcaatgcaaaaatgagagcttgtggatggcatgtgctcgaagtggcggatggcaactat
gatgttcaagccgtcactactgcactagctcatgcccagtcactcagaggcaagccagtc
tttatcaacattcgcacagtgattggagttgggactcaggtagctggtacccataaagcc
caccacggcacgtttgacaaagagagtgtgcaattatcaaaacagcttgctggacaagac
cccaacctaactcacgtcatacccgagaagccgctcaagtatttcagagactgcaaggcc
aaaggcgagtctcttgagagcaagtggaatgatctactgggtgaatacagcacaaagcat
ccagatctcgccgctgattttcggcaggctgtatcgggcgactatggtacgaagtggctc
gatattctcaaagccacagatagtgcgcaattcaagggaacagccacccgggatgtgaac
ggcagtctgatcgaagccatctggaaggatttcccagcgctctgtggtggcggtgctgac
ctcgtcaactccaacaaggttcactacaccgagtcggatgtgtttcatccctcagtcagc
tatgccgggcgttacgtccgctatggtattcgcgaacatgccatggcggccatctccaac
ggtctggctgcctacaaccccgggacctttcggccagtcactgcgactttcctaatcttc
ttcctctatgctgctccgggtattcggatgggtgcccttagccacctcccagtgatccac
ttcgcaactcacgacagcttcgctgaaggccaaaatggacctacccatcaacctgtcgag
ctagactctcttttccgcgccatgcccaacctttcttacatgcggccatgcgatgctgag
gaaaccattggcgcctggatgcttgctctaggcaagactagcggcccttccatgttgtcc
ctcggacgagatcccactggtcctgttccatcaacggatcgctacaaagtggccaagggc
gcatacgtcgtcgtcgatcagacaaactccaagctcacgctcgccagctgtggcacgaac
cttcactacgcagtagctgctgcggagttactcacatccgaggggttgccgacgcgtgtg
gtgagctgtcctagctttgagcattttgatcagcaggaccagcagtaccgtgacagtgta
ttccccaaggatggatccccgattgtcagtgtggaagaatatgttgccacaacttgggcg
agatatgtgacggctagtatcggtatgcaaagttatggcttttctgcatcgaatcctagt
aattatgctcgatttgggctggattcggaggggataatcagaagaacgaagcagtatctg
aaggacatggaaggaaagaacgcgcgtatggaaggatggcgacagatttga

DBGET integrated database retrieval system