KEGG   Pestalotiopsis fici: PFICI_10731Help
Entry
PFICI_10731       CDS       T04924                                 

Definition
(RefSeq) Exoglucanase 2
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00500  Starch and sucrose metabolism
pfy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PFICI_10731
Enzymes [BR:pfy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     PFICI_10731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_6 CBM_1
Motif
Other DBs
NCBI-GeneID: 19275744
NCBI-ProteinID: XP_007837503
UniProt: W3WUQ9
Position
Unknown
AA seq 474 aa AA seqDB search
MAVKIWILTVLSALALAIPLDGPIEERQSCAALYGQCGGTGWSGATCCASGTCVLSNEYY
SQCLPSSGTTTAGTTRSTTTSAATSTKTSTTTSKATTSASSASTKTTTAPVGSGTATWSG
NPFSGVAQWANNYYASEVTAYAVPTLGAKAAAVADVPSFMWLDTLSKTDLMEDTLADIRT
ANQAGASPANAGIFVVYDLPDRDCAAAASNGEYSIANNGVANYKNYIDTIVAIVKKYSDV
RILLVIEPDSLANLVTNLSVSKCSNAQSAYLECINYALTNLNLPNVAMYLDAGHAGWLGW
PANLSPAATLFAQVYSDAGSPAALRGLATNVANYNGWSVSSAPSYTQGNANYDESHYVAA
IAPLLSAAGFDAHFITDTGRSGKQPTGQLAWGDWCNVIGTGFGTRPTANTGSDLLDAFVW
VKPGGECDGTSNTTATRYDYHCGLADALQPAPEAGTWFEAYFEQLFTNANPAFT
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcaagatctggattctcactgttctcagtgctctcgctttagccattcctctt
gatggtccaattgaagagcgtcaatcctgtgctgcactttacggtcaatgtggtggaaca
ggatggtcaggggcgacttgctgtgcatcaggcacatgtgttctaagtaatgaatactat
tctcagtgcttgccatcatctggaacaaccacggccggaacaacgagatcgacaaccact
tccgctgccacatcgacaaagacctctaccacgacgtccaaggctacgaccagtgcaagc
tcggcttctacaaagacaacgacagctccagtcgggagtgggactgctacatggagtggt
aacccattttcaggggttgctcagtgggcaaataattactacgcatccgaggtcacagca
tatgctgtaccaactcttggcgccaaagctgcggccgttgcagatgtgcccagcttcatg
tggcttgataccctttctaaaaccgacttgatggaagatacactggctgatatccgtact
gccaaccaggctggcgcgagtccagccaacgccggtattttcgtcgtctatgatcttccc
gaccgcgactgtgcagcggcagcttcgaatggtgaatactctatcgccaacaatggggtg
gccaactacaagaactatatcgatacaatcgttgccattgtcaagaaatactcggatgtt
cggattctactcgttattgaacccgatagtctagccaacttggtcacaaacttgagcgta
tccaagtgttccaatgctcagagtgcctacctggaatgcatcaactatgccctaacaaac
ttgaatcttccaaacgttgccatgtatctcgatgctggccacgcaggatggcttggatgg
ccggcgaatttgtcccctgccgcgacacttttcgcacaggtctacagcgatgccgggtct
ccggccgctctgcgtggtcttgctaccaatgttgccaactacaatggctggagcgtcagc
tcggccccgtcgtatacgcagggcaacgccaactacgacgaatcacactatgttgctgcc
attgctcctctcctctctgccgccggcttcgatgctcactttatcaccgacactggccgc
agcggcaagcagcccaccggtcaactcgcctggggagactggtgcaacgtcatcggcact
ggctttggtactcgtcccactgctaacacgggaagtgacctcctcgatgcgttcgtttgg
gtaaagcctggcggcgagtgtgatggaacgagcaacaccaccgcgacacgctacgactac
cattgtggtcttgcagatgctcttcaaccggctcccgaggcaggcacctggtttgaagcc
tactttgaacagctatttaccaatgcaaatcctgccttcacctaa

DBGET integrated database retrieval system