KEGG   Pestalotiopsis fici: PFICI_12219Help
Entry
PFICI_12219       CDS       T04924                                 

Definition
(RefSeq) Glutamyl-tRNA(Gln) amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00970  Aminoacyl-tRNA biosynthesis
pfy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PFICI_12219
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pfy03029]
    PFICI_12219
Enzymes [BR:pfy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     PFICI_12219
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     PFICI_12219
Mitochondrial biogenesis [BR:pfy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    PFICI_12219
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-GeneID: 19277232
NCBI-ProteinID: XP_007838991
UniProt: W3WMZ9
Position
Unknown
AA seq 632 aa AA seqDB search
MPRASTAALSRYLLHGQVTRRGCLRSLQATAASSRRPVSVPAALSSSRCVHTETQAPTAA
TVVAPSTAAAHVPLRKQLKDEAKKAKASGKKKKKNANNQLVEGWELTVGIEIHAQLNTAR
KLFSPAATSFNDEPNSHVAYFDLATPGSQPLFQKETLIPALRAALALNCDIQSTSRFDRK
HYFHWDQPSGYQITQYYEPFARDGHITLQPRDGIALEDGDGLRIGIKQVQMEQDTAKTMA
QAENTHWIDFNRTGVPLIEIITHPDIHHPATAAAFVRKVQILLNAVDSCVSGMEAGGLRA
DVNVSVRRTNDPKGPLGTRTEIKNLSSFKAVEDAIIAERDRQIAVLEAGGTIEGETRGWS
IGSTETRRLRGKEGEVDYRYMPDPDLSPLFIGQDLISRLRGTLGQLPDAEVDELVQEFQL
TPKDALSLVALDGGNRVEYFWNVIDALVSRLPAEATSNLACFQLAANWILHELGRLTANP
HDDSVSELGFTADGQCERVPVDYLADILLFLHQRQITMKVAKELLWVVFRGTVPSQYASI
ADAIESENMWFNELSDEEYAELADSAIEGQDHIVQQFVEYKQYPQGKLMFLVGRMLRLGA
EERINPQNAEKAMRNALEEKYVPMLRAHTSEQ
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgcgcatcgacggcggccctcagcagatacttgctgcacggccaagtgacgagg
cgcggctgtctgcgatcacttcaagccacagcagcatcatctcggcgaccagtctcagtt
cctgctgccctttcgagttcacgatgcgtccacactgaaacgcaagccccgacggctgcc
accgtggtagcaccctcgactgctgcagcccatgtgccccttcgaaagcaattgaaggac
gaggcaaagaaggccaaggcgtcgggaaagaagaagaagaagaatgccaacaaccagttg
gttgagggctgggaattaacggtgggcattgagatccacgcacaactcaatacggccagg
aagctcttctctcctgctgccacctcattcaacgatgagcccaacagccatgttgcatac
tttgatcttgctactcccggaagccagccgctctttcagaaagagaccttgatcccagca
cttcgagctgcactggccttgaattgcgatatacagtcaacaagccgcttcgacaggaaa
cattactttcactgggatcagccatcggggtatcaaattacgcagtactacgagcccttt
gcgcgcgatggacatatcactctgcaaccaagagacgggatagccctcgaggatggcgat
ggtctcaggataggtatcaagcaggttcaaatggaacaagatacggcgaaaacaatggca
caggcggaaaatacacactggatcgacttcaaccgaaccggcgtgcctttgattgaaatc
atcacccacccagatatccaccacccagcaacagccgctgcttttgtgcgcaaggtccag
attctcctcaatgctgtcgactcttgtgtatcaggtatggaagcgggtggacttcgggcc
gatgttaatgtctccgtcaggagaaccaatgacccgaaaggccccctaggaactcgcacc
gagatcaagaacctgagtagcttcaaagctgtcgaggatgccatcattgctgagcgcgac
aggcagattgccgttcttgaagcaggtgggaccattgagggagaaactcgtggctggtct
atcggttcgacagaaacccgaagactccgaggcaaggaaggcgaggtcgactaccggtac
atgcctgatccggatctttcgccgctcttcattggccaggacttgatcagtcggttacga
ggtaccctgggccaactgccagatgctgaagtagatgagcttgttcaagagtttcagctc
actcccaaagatgcgctctcgctagtcgctcttgatggtggcaacagagtcgagtacttt
tggaatgtcattgatgctctggtgtctagattacctgctgaagcaacctcgaacctcgcc
tgcttccaattagctgcaaattggattctccacgaacttggacgtctgacggcgaatcct
catgacgattcagtctcggagctcggcttcacggctgacggacagtgcgagcgtgttcct
gtcgactacttggctgatattctgctctttctccatcaacgacagattaccatgaaggtt
gccaaggaactcctctgggtagtgtttcgaggcactgttccctctcaatacgcaagcatt
gctgatgccattgagtcggaaaatatgtggttcaatgaactatctgacgaggagtatgcc
gagttggcggattctgcaatcgaaggacaggatcatattgtgcaacaattcgtcgagtat
aagcagtatcctcaaggaaagctcatgttcctagtcggacgcatgctgaggctaggcgca
gaggagagaatcaacccacaaaacgcagaaaaggccatgcggaacgctctagaagagaaa
tatgtcccaatgctcagggctcacacgtcagaacagtaa

DBGET integrated database retrieval system