KEGG   Pestalotiopsis fici: PFICI_14163
Entry
PFICI_14163       CDS       T04924                                 

Definition
(RefSeq) Nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00910  Nitrogen metabolism
pfy01100  Metabolic pathways
Module
pfy_M00531  Assimilatory nitrate reduction, nitrate => ammonia
pfy_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    PFICI_14163
Enzymes [BR:pfy01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     PFICI_14163
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Fer2_BFD Rieske_2 Rieske NIR_SIR_ferr Rubredoxin_C Pyr_redox_3 Amino_oxidase
Other DBs
NCBI-GeneID: 19279176
NCBI-ProteinID: XP_007840935
UniProt: W3WMD1
Position
Unknown
AA seq 1113 aa
MAASSRKKLVVVGLGMVGVAFIEKLLKLDARSREYDIVVIGEEPHLAYNRVGLTSFFDHR
KVENLYLNPQDWYASHAPENKLGYHLNTLVTAINPQDKTVACSNGDVVSYDILVLATGSD
AVLPRHTPGHDAKGVFVYRTIDDLERLIAFGDKCKGTVGAVVGGGLLGLEAAKAMMDLQC
FSKVKLVERNRWVLSRQLDQDAGTLVVDKVTALGVDILLSKRVGEIQRDQDNNVTGVVFE
DGEQMECSTICFAIGVRPRDSLASSAGIKCADRGGGIIVNDDLSTSVPDIYAIGECASWQ
NQTFGLIAPGIEMADVLSFNLTQAKLHRPRVFKRPDLSTKLKLLGVDVASFGDFFADRDG
PSHLPALTYKDPFQAVYKKYIFTADGKYLLGGMMIGDTSDYIKLVPMVKNQKELEIPPSQ
LILGAKKEGQDDGDDLDDDTQICSCHNVTKGNVVDVVKKGTCKSLGDVKACTKAGTGCGG
CMPLVTTIFNKTMKDMGAEVTNHLCSHFSYSRADLYNIVMVKRLKTFQDVMRDAGNDKES
EGCEACKPAVASIFASLWNRHVMDRTTHGLQETNDRFMANIQRNGTFSVVPRVSAGEITP
DKLIVIGQVAKKYGLYTKITGGQRIDMFGAKKQDLLAIWNELVAAGMESGHAYAKSLRTV
KSCVGTTWCRYGIGDSVGMAVRLEERYKSIRAPHKIKGGVSGCVRECAEAQSKDFGLIAT
DKGFNIFVAGNGGAKPKHAELLAKDVPPAEVVPILDRYLMFYMRTADKLQRTARWIEQLP
GGLKYLQDVVLRDKLGICASLEAQMQELVDSFFDEWAEAVKSPEIAAKFRQFANTDEGAD
GMDVELDRDQARPVMWAKDSATADFKGLRARWSSTSWQPVIEAAHFAGADDTPNGISANV
KRGDTQLALWRVRGRYYATQQMCPHKRTFILSDGLVGLDPSAASTAASADTNAPPSPPPS
PTSSTAEAVTATTAAKTTTTTPSAEPCGDAKSPWVSCPYHKRNFDLTSGDCKNDSELSIA
TFEVQERDDGLVHIKLPPVDELDRELGTKRWMVKKGEAGETQFADLDRKIGFKGLRAKKP
GVRPMGDATMRKPVEVLAQSAHGGCGGPAGIDW
NT seq 3342 nt   +upstreamnt  +downstreamnt
atggcggccagctcgaggaagaagctggtcgtggtcggcctgggcatggtgggtgtagcc
ttcatagaaaaactgctcaagctggacgcccggagccgcgaatacgatatcgtggtgatc
ggcgaggagccgcatctcgcgtacaaccgcgtgggtctcacgagtttctttgaccaccgc
aaagtcgagaacctctacttgaatccgcaggattggtatgcctcacacgcaccagagaac
aagctgggataccacttgaacacgctggtgacggccatcaacccgcaagacaagaccgta
gcgtgctctaatggcgacgtcgtgtcctacgatattctggtcctggccaccggctccgac
gccgtgctcccgcgccatacccccgggcacgatgctaaaggagtatttgtctaccgcacc
attgatgacctcgagagactcattgcctttggggacaagtgcaagggcaccgtgggcgcc
gttgtcggcggcggtctcctgggcctcgaggccgccaaggccatgatggacctgcagtgc
tttagcaaggtcaagctggtcgagcgtaaccgctgggttctgagccgccagctcgatcag
gacgccggcacgctggtcgtggacaaggtcacggcgctgggtgtcgatattctgctgagt
aaacgcgtgggcgagattcagagagaccaggacaacaacgtcactggtgttgtctttgag
gacggcgagcagatggagtgctcgactatttgtttcgccattggtgtgcggccacgggac
agcctggccagcagcgctggtatcaaatgtgccgaccgaggtggcggcatcattgtcaat
gatgacctcagcaccagcgtacctgatatctacgccattggcgagtgtgccagctggcag
aatcagacttttggcttgattgctccgggtatcgagatggcggacgtactctcgtttaac
ttgacgcaggcaaagcttcatcggccaagggtcttcaagcgacctgatctcagtaccaag
ctcaagcttctaggcgtcgatgtggctagttttggtgacttttttgcagaccgcgatggt
cctagtcatctgccggccctcacctacaaagatccgttccaagccgtgtataaaaagtac
atcttcactgctgatggaaagtacctgctgggtggcatgatgattggagataccagcgac
tacatcaaactagtacccatggtcaagaaccagaaggagctcgaaattccgccgtcgcag
cttatcctgggagcaaagaaagaaggccaagacgacggggatgatctggacgacgacaca
cagatctgctcgtgccacaatgtcacaaagggcaatgtggtggatgttgtcaagaaggga
acttgcaagtctctgggcgacgtcaaggcgtgcaccaaggccggtactggctgcggtgga
tgcatgcccttggtcactaccatcttcaacaagaccatgaaggacatgggcgccgaggtc
accaaccacctgtgctcgcactttagctactcgcgggctgacctctacaatattgtcatg
gtcaagcggctcaagacgttccaggacgtgatgcgcgatgctggcaacgacaaggagtcc
gagggctgtgaggcatgcaaaccagccgtcgccagcatctttgccagtctgtggaaccgg
cacgtcatggaccgcaccacacatggtctacaagagacaaacgaccgcttcatggccaac
atccagcgaaacggcaccttttccgtggttcccagagtgtcggctggcgagatcacacca
gacaagctgatagtcattggccaggttgccaaaaagtatggcctatacaccaaaatcact
ggcggccagcgtatcgacatgtttggcgccaagaagcaagacctgctcgccatctggaat
gagcttgtcgctgccggcatggagagcgggcacgcctatgccaaatctctgcgaacagtc
aagagctgtgttggcactacgtggtgcagatacggcatcggcgatagcgtaggcatggcg
gtgcgccttgaggagaggtacaagagtattcgcgctccgcacaagatcaagggtggtgtg
tctggctgtgtgcgggagtgtgccgaggcacagagcaaagactttggactcatcgccacc
gacaagggcttcaacatcttcgtggccggcaatggcggcgccaagcccaagcacgcagag
ctgctcgcaaaggacgtacccccggccgaggtggtccccattctagatcgttatctcatg
ttctacatgcgcaccgccgacaagctccagcgcacggcgcgatggatcgagcagctcccc
ggtggactcaagtaccttcaagacgtggtgttgcgcgacaagctcggcatctgtgcgtcg
ctcgaggcacaaatgcaggagctggtcgactccttctttgatgagtgggccgaggccgtc
aaaagccccgagatcgccgccaagttccggcagtttgccaacacggacgaaggcgccgac
ggcatggatgtcgagctagaccgtgaccaggctcgtcctgtcatgtgggccaaggactcg
gccactgccgacttcaagggcctgcgtgctcgctggtcgtcgacgtcgtggcagcccgtc
atcgaggctgctcatttcgccggcgccgacgatacgcccaatggcatctcggccaacgtc
aagcgcggtgatacccagctggccctctggcgcgttcgcggtcggtactacgccactcag
cagatgtgcccacacaagcggacgtttattctgagcgacggcctggttggtctcgatccg
tcagcagcgtccactgctgcctccgccgataccaacgcaccaccctcaccaccaccctcg
ccgacatcatccaccgccgaagccgtgacagccacgacggcggcgaagacgacgacgaca
accccatctgcagaaccctgtggcgacgccaagtccccctgggtctcgtgtccatatcac
aagcgcaactttgatcttacgtcgggcgactgcaagaacgacagtgagctcagcattgcg
acattcgaggtccaggagcgggatgatggcctagtgcacatcaagctccctcccgttgat
gagctggaccgcgagctagggaccaagaggtggatggtcaagaagggcgaggctggggaa
acccagttcgccgacctcgacaggaagatcggcttcaagggtttgcgggccaagaagcct
ggggtccgccccatgggcgatgcgactatgcgtaagcctgtcgaagtgctggcccagtct
gcccatggaggttgcggtggaccagctggtatcgattggtaa

DBGET integrated database retrieval system