KEGG   Pestalotiopsis fici: PFICI_14859Help
Entry
PFICI_14859       CDS       T04924                                 

Definition
(RefSeq) hypothetical protein
  KO
K05292  GPI-anchor transamidase subunit T
Organism
pfy  Pestalotiopsis fici
Pathway
pfy00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
pfy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfy00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    PFICI_14859
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 19279872
NCBI-ProteinID: XP_007841631
UniProt: W3WHK8
Position
Unknown
AA seq 619 aa AA seqDB search
MMHSWNSFLFTLLSSLLLCTCTAASDYHEQLVLKPLPQNSLLASFNFKSNTSVAAFEAHN
FQFFPRSLGQILQHAGTRELHLRFSLGRWDAETWGARPWDGTKEGGTGVELWAWLEAETT
EEADHKWLTLTNALSGLFCASLNFIDSTRTIRPVMSFRPEGNHPNATLANMHLLHGVLPR
EVVCTENLTPFLKLLPCKGKAGISTLLDGHKLFDASWQSMAIDVRPICPAGQECVLEIEQ
TIDMVLDIERSKRPRGNPIPRPPPGHELKCDTSKEYHARDTCFPTETLSPQDWTISQVFG
KSMKGTCPLANPDVPPVCVQAPHERHVFTSSGVTELKVKDTERCYFVPPEDDFELVLPHM
QHDDDANLPATEEYVKPERPFLYAERSFTGHGQQRGGVQTIFTNPSPDAEVEFVYLESLP
WFMRIYLHTLQARISHKTGVDKGKALVDENSVIQEIYYRPFLDRERGTQLELRMRIPPAS
TVFMTYDFEKTILRYTEYPPDANRGFDVAAAVITILPPTGKTSNLRTTSLLLNLPTPDFS
MPYNVIIFTSTAIALAFGGLYNILVRRFVGGDEGPEVSVVKLRRKIQEAVGRLKLKLAKP
ATKTLDVAMAHEKAGEKVD
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgatgcattcctggaattcttttctattcactctcttgtcctcattactgctttgtaca
tgcactgccgcttccgactatcatgagcagttggtcctgaagcctctgccgcaaaactcc
ctcctagccagtttcaacttcaagtcgaatacctctgtcgccgcgtttgaagcgcacaac
tttcaattctttcctcgatcactaggacagatcctacagcatgcaggcacgcgagagcta
cacctgaggtttagtctcggacgatgggacgcggaaacatggggagcaagaccgtgggat
ggcaccaaagaagggggtacgggtgtcgagctttgggcgtggctggaagccgagacgacc
gaggaagctgatcacaaatggttgaccctgaccaatgcgctctcgggtctcttttgcgcc
tcgctcaactttatcgattcgacaaggactatacggcctgtcatgtcctttcgacccgaa
ggcaaccatcccaatgccacgctcgccaatatgcacctacttcatggcgtcttgcccaga
gaggttgtttgcaccgagaacttgactccgtttttgaagcttcttccgtgcaagggcaag
gctggaatttccactctactagatggtcacaaattgtttgatgcctcatggcagagcatg
gcgattgatgtacgaccaatttgcccggctggtcaagaatgtgtcttggagattgaacaa
accattgacatggtcttggatattgaaagatctaaaagaccaagaggcaatcctatccct
cggccgccgcccggccacgagctcaagtgcgatacaagcaaggaatatcatgccagagat
acgtgtttcccaaccgaaactctttctcctcaggattggaccatttcgcaggtatttggc
aagtccatgaagggcacctgtccgctggccaatcctgatgtgcctcctgtctgcgtccag
gctccccatgaacgccacgtctttacatcctctggggtgactgagctcaaggtcaaggac
actgaaagatgctactttgtgccgccagaggacgactttgagcttgtccttccccacatg
cagcacgacgacgacgccaatctgcctgccactgaagaatatgtcaagcccgagcgcccc
ttcttgtacgccgagagaagtttcaccggacacggacagcaacgtggcggagttcagaca
atctttaccaaccccagtccagatgccgaggttgaattcgtctacttggagagtctaccc
tggttcatgcggatatatctgcatactctacaagcccgcatttctcacaagactggcgta
gacaagggcaaagcactagttgacgaaaacagtgttatccaagagatttactaccggccc
tttcttgaccgagagagggggacccagctggagctcaggatgcggatcccaccagccagt
accgttttcatgacatatgactttgaaaagacgattctacggtacaccgagtatcctcca
gacgctaaccgtggttttgacgttgctgctgccgtcatcaccattctccctcccacgggg
aagacgagcaacctaaggacgacgagtctgttgctcaatctccctactccggatttctcc
atgccttacaatgtcatcatcttcacaagcacagcaattgcacttgcattcggaggcttg
tataacattcttgtccgaagatttgttggcggtgacgagggaccagaggttagtgtggta
aaacttaggcgaaagatacaggaagctgtaggacgactcaagcttaaactggctaaacca
gccaccaagactttagatgtagccatggcacacgaaaaggctggggaaaaggtggactag

DBGET integrated database retrieval system