KEGG   Pseudomonas fragi: AV641_02565Help
Entry
AV641_02565       CDS       T04285                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
pfz  Pseudomonas fragi
Pathway
pfz03010  Ribosome
Brite
KEGG Orthology (KO) [BR:pfz00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    AV641_02565
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:pfz03011]
    AV641_02565
Ribosome [BR:pfz03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    AV641_02565
  Bacteria
    AV641_02565
  Archaea
    AV641_02565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AMB78026
UniProt: A0A109R815
Position
552566..552898
Genome map
AA seq 110 aa AA seqDB search
MEVAAKLSGARISAQKARLVADQIRGKKVGEALNLLAFSNKKAAEIIKKVLESAVANAEH
NEGADVDDLKVATVFVNEGRSLKRIMPRAKGRADRIVKRSCHITVKVADK
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagtagccgctaagttgtcgggcgctcgaatctccgcccagaaagcccgcttggtc
gccgaccagatccgcgggaagaaggtgggcgaagcgctcaacctgttggctttcagcaac
aagaaagccgccgagatcatcaagaaagtgctggagtcggccgtagccaacgccgagcat
aacgaaggcgcagacgttgacgaccttaaggtcgctaccgttttcgtcaacgaagggcgt
tcgctgaagcgcatcatgccgcgtgccaaaggccgcgctgatcgcatcgtcaagcggtct
tgccatatcactgtcaaggttgctgacaagtaa

DBGET integrated database retrieval system