KEGG   Pseudomonas fragi: AV641_03690Help
Entry
AV641_03690       CDS       T04285                                 

Definition
(GenBank) RNA pseudouridine synthase
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
pfz  Pseudomonas fragi
Brite
KEGG Orthology (KO) [BR:pfz00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:pfz03009]
    AV641_03690
Enzymes [BR:pfz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     AV641_03690
Ribosome biogenesis [BR:pfz03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AV641_03690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AMB81729
UniProt: A0A0X8F0S4
Position
789064..790026
Genome map
AA seq 320 aa AA seqDB search
MSEKIQLREEVPSELGGQRLDQVAAQLFAEHSRSRLSAWIKDGRLTVDGAVIRPRDIVHG
GAILELTAEQEAQGEWVAQDIPLDIVYEDDDILVINKPAGLVVHPAAGHADGTLLNALLH
HVPDIINVPRAGIVHRLDKDTTGLMVVAKTIQAQTQLVTQLQSRSVSRIYECIVIGVVTA
GGKIDAPIGRHGQQRQRMAVMEGGKQAVSHYRVLERFRSHTHVRVKLETGRTHQIRVHMS
HINFPLVGDPAYGGRFRIPPAASVTMVESLKNFPRQALHARFLELDHPTTGKRMSWESPL
PDDFVWLLTLLKQDREAFVG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagaaaattcaacttcgcgaagaggtgccgtccgaactgggtggccaacgcctc
gatcaagtcgccgcacaattattcgctgagcactcgcgctcgcgcctttccgcctggatc
aaagacggccgcctcactgtggacggagcggtcatccgcccccgtgacatcgtgcatggt
ggcgccatcctggagttgactgccgagcaggaagcccagggtgagtgggtcgcccaagac
attcctctggatatcgtttacgaagacgatgacatcctggttatcaacaagcctgccggc
ttggtggtacacccggctgccgggcatgccgacggtactttgctcaatgcgttgctgcat
cacgtaccggacattattaatgtgccgcgtgcggggatcgtgcaccgtctggacaaagac
accaccggtctgatggtggtcgccaagaccatccaggcgcagacgcaactggttacacag
ttgcagagccgcagtgtcagccgaatctatgagtgcattgtcattggtgtcgttactgcc
gggggcaagatcgatgcgcccatcggccgtcacggccagcaacgccagcgtatggcggta
atggaaggcggcaagcaggcggtgagtcattaccgtgtgcttgagcgtttccgttcccac
acccatgtgcgggtcaagctggaaaccggtcgtacgcaccagattcgtgtgcatatgtcc
cacatcaacttcccgttggtcggagaccctgcctatggcggtcgcttccgtatcccgccg
gcagccagtgtgacgatggtcgaatccctgaaaaacttcccgcgtcaggctctgcacgcg
cgcttccttgagttggatcatccgacgaccggtaagcgcatgagctgggaatcgccactt
ccggacgattttgtctggctgttgacgttgctcaagcaagaccgagaggcatttgtcggg
tga

DBGET integrated database retrieval system