KEGG   Pseudomonas fragi: AV641_06315Help
Entry
AV641_06315       CDS       T04285                                 

Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
pfz  Pseudomonas fragi
Pathway
pfz00640  Propanoate metabolism
pfz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pfz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AV641_06315
Enzymes [BR:pfz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     AV641_06315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AMB81753
UniProt: A0A0X8F1L8
Position
1346944..1349535
Genome map
AA seq 863 aa AA seqDB search
MNTEFRKTLPGTRLDYFDTRAAVDAIKPGAYDTLPYTSRVLAENLVRRCDPATLNASLSQ
LIERKRDLDFPWFPARVVCHDILGQTALVDLAGLRDAIALQGGDPAQVNPVVPTQLIVDH
SLAVERDGTDPEAFEKNRAIEDRRNEDRFHFIEWTKKAFKNVDVIPPGNGIMHQINLEKM
SPVIQVRDGVAFPDTCVGTDSHTPHVDSLGVIAIGVGGLEAESVMLGRASWMRLPEIVGV
ELTGKLQPGITATDMVLALTEYLRKQKVVGAWLEFFGEGAAALTLGDRATISNMAPEYGA
TAAMFYIDQQTIDYLKLTGREDQQVQLVENYARLTGLWGDSLKHAEYERGLSFDLSSVVR
NMAGPSNPHARVATSDLAAKGIAGQWDDVPGQMPDGAVIIAAITSCTNTSNPRNVIAAGL
IARNANKLGLTRKPWVKSSLAPGSKTVALYLDEAGLTDELEQLGFGVVAFACTTCNGMSG
ALDPQVQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTIRFDIE
KDVLGLDASGNEVRLKDIWPSDEEIDAVVKRSVKPEQFRQVYIPMFAIHEDTGPKVEPLY
DWRPQSTYIRRPPYWEGALAGARPLKGMRPLAVLPDNITTDHLSPSNAIMLDSAAGEYLA
KMGLPEVDFNSYATHRGDHLTAQRATFANPKLFNEMVIEDGKVKQGSLTRLEPEGQVMRM
WEAIETYMDRKQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAIAAEGFERIHRTNLVGMG
VLPLEFMPGTNRKTLQIDGSETYDVIGERTPRATLTLVITRNNGERVEVPVMCRLDTAEE
VSIYEAGGVLQRFAQDFLESATA
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgaatactgaatttcgcaaaacactaccgggcacccggctggattatttcgacacccgc
gcggcagtcgatgcgatcaaacccggtgcttatgacaccctgccatacacctcccgggta
ctggccgaaaacctggtgcgtcgctgtgatcctgcgaccctgaacgcctcattgagccag
ttgattgaacgcaaacgcgatctcgactttccgtggttcccggcgcgagtggtgtgccac
gacattctcgggcagaccgcgctggtcgacctcgccggtttgcgcgacgccattgccctg
caagggggcgacccggcgcaagtgaacccggtggtcccgacccagctgattgtcgatcac
tcgttggcggttgagcgtgacggcaccgatcccgaggcgtttgaaaagaaccgcgccatc
gaggatcgccgtaacgaagaccggttccactttattgagtggaccaaaaaagccttcaaa
aacgtcgatgtgatcccgccaggcaacggcatcatgcaccagatcaacctggagaaaatg
tctccggtgattcaggtgcgtgacggtgtggcattccccgatacctgcgtcggcaccgac
agccacaccccccacgttgattcgctgggcgtcattgccattggcgtcggcggtcttgaa
gccgagagcgtgatgctcggtcgtgcctcctggatgcgcctgccggaaatcgtcggcgtc
gagctgaccggcaagctgcagccgggcattaccgctaccgatatggtgctggcgctgacc
gagtatctgcgcaagcaaaaagtcgtcggtgcctggctggagttcttcggcgaaggtgct
gcggcgttgaccctgggggaccgcgccaccatctccaacatggccccggaatacggcgcc
acggctgcgatgttctacatcgaccaacaaaccatcgactacctcaagctgaccggtcgt
gaagaccagcaagtgcagttggtcgaaaactacgccaggctcaccgggctgtggggcgac
agtctcaagcatgctgagtatgagcgtggcttgagctttgacctgtccagtgtcgtgcgc
aacatggccggcccgagcaacccccacgcccgcgtcgccaccagcgacctcgcggccaag
ggcattgccggtcagtgggacgacgtgccggggcaaatgcctgacggcgcggtaattatt
gcggccatcaccagctgcaccaacacgagcaacccgcgtaacgtgattgcggcaggcctg
atcgcccgcaacgccaacaaactggggctgacccgcaagccttgggtcaagtcgtcgttg
gcaccgggttcgaaaaccgtcgcgctgtatctggacgaagccggtctgaccgatgagctt
gagcaactgggctttggtgtggtcgcttttgcctgtaccacctgcaatggcatgtccggt
gcgctggatccgcaagtgcagcaggagatcatcgatcgcgatctctacgcgacggccgtg
ctctcgggtaaccgcaactttgacgggcggattcacccgtacgccaagcaggcatttctg
gcttcgccgcctttggtagtggcctatgcaattgccgggaccatccgtttcgatatcgaa
aaagatgtgttgggcctggatgccagcggcaacgaagtgcgtctgaaagatatctggcca
agcgacgaagaaatcgacgccgtggtcaagcgctcggtcaagccggagcagttccgtcag
gtttatattccgatgttcgccattcacgaagacaccggcccgaaagtcgagccgctctac
gactggcgcccgcaaagcacttacattcgtcgtccgccgtattgggaaggggctctggcc
ggtgcacgtccgctcaagggcatgcgcccgctggcagtgctgccggacaacatcaccacc
gatcacctgtcgccgtccaacgcgatcatgctcgacagtgccgcaggtgagtatctggcg
aaaatgggcctgccggaagtcgacttcaactcctatgcaacccaccgtggcgaccacctg
accgcgcaacgtgccacctttgccaaccccaaactgttcaacgaaatggtgatcgaggac
ggcaaggtcaagcagggctcattgacccgtcttgagcctgaaggccaggtgatgcgcatg
tgggaagcgattgaaacctacatggatcgcaagcagccgttgatcatcattgccggcgcc
gactacggtcagggctcgtcccgtgactgggcggccaagggcgtgcgtctggccggggtc
gaagccattgcggcagagggctttgagcggattcaccgtaccaacctggtcggcatgggc
gtgttgccgctggagttcatgccgggcaccaatcgtaaaaccctgcagattgacggcagc
gagacttacgacgtgatcggcgagcgcaccccgcgtgccacgctgaccctggtgattacc
cgcaacaacggcgagcgcgtcgaggtgccggtgatgtgccgtctggacaccgctgaagaa
gtctcgatctacgaagcgggcggcgtgttgcagcgctttgcccaggacttcctggaatcg
gccacggcttaa

DBGET integrated database retrieval system