KEGG   Pseudomonas fragi: AV641_10375Help
Entry
AV641_10375       CDS       T04285                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pfz  Pseudomonas fragi
Pathway
pfz00071  Fatty acid degradation
pfz00072  Synthesis and degradation of ketone bodies
pfz00280  Valine, leucine and isoleucine degradation
pfz00310  Lysine degradation
pfz00362  Benzoate degradation
pfz00380  Tryptophan metabolism
pfz00620  Pyruvate metabolism
pfz00630  Glyoxylate and dicarboxylate metabolism
pfz00640  Propanoate metabolism
pfz00650  Butanoate metabolism
pfz00900  Terpenoid backbone biosynthesis
pfz01100  Metabolic pathways
pfz01110  Biosynthesis of secondary metabolites
pfz01120  Microbial metabolism in diverse environments
pfz01130  Biosynthesis of antibiotics
pfz01200  Carbon metabolism
pfz01212  Fatty acid metabolism
pfz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pfz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AV641_10375
   00630 Glyoxylate and dicarboxylate metabolism
    AV641_10375
   00640 Propanoate metabolism
    AV641_10375
   00650 Butanoate metabolism
    AV641_10375
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AV641_10375
   00072 Synthesis and degradation of ketone bodies
    AV641_10375
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AV641_10375
   00310 Lysine degradation
    AV641_10375
   00380 Tryptophan metabolism
    AV641_10375
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AV641_10375
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AV641_10375
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AV641_10375
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pfz04147]
    AV641_10375
Enzymes [BR:pfz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AV641_10375
Exosome [BR:pfz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AV641_10375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: AMB79440
UniProt: A0A109R852
Position
2281429..2282670
Genome map
AA seq 413 aa AA seqDB search
MSAGGQYSVFTDAAIIDALRTPWVDFNGALAEVSPIDLGIKVGREVLARAGVDPQGVDSV
LAGSMAQASFDAYLLPRHIGLYSGVPQSVPALGVQRICATGFELLHQAARQLDDGVQLAL
CVAAESMSRNPIAAYTHRGGFRLGASVQFKDFLWEALFDPAPGLDMIATADNLARRYGLS
RETVDAYACDSHRRALAAQQTGWLAPEIVAVGHQTFDLDGYQPRGITLPRGVDTVSEDSH
PRPAELAALARLRAVHQGGVQTAGNSCAVVDGAAAALVARTSACRDTPLALLRASAVVGV
APEFMGIGPAPAIRLLLQRSGLELNQIGRYEINEAQAAQVLAVAQELELDHSRLNVQGGS
LALGHPLAASGLRLVLTLARQLREHNLRYGIAAACVGGGQGMALLIENPGWCA
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgctggcggtcagtactcggttttcaccgacgctgccatcatcgatgcgctgcgt
acaccctgggtcgacttcaatggtgcgctggccgaggtgtcgccgatcgacctgggaatc
aaggtcgggcgcgaagtgttggcccgcgcaggggtcgatccgcaaggggtggacagcgta
ctggcgggctccatggcccaggccagtttcgatgcttacctgctgccacggcatatcggc
ctctacagcggcgtgcctcaatcggtaccggcattgggggtgcagcgcatctgcgccacc
ggtttcgaacttctgcaccaggctgccaggcagttggatgacggcgtgcaactggcgctg
tgcgtagcggccgaatccatgtcgcgcaatccgattgcggcgtacacccatcgtggcggt
tttcgcctcggtgccagcgtgcagttcaaggattttctctgggaagcactgtttgatccg
gcccccgggctggacatgatcgccacggccgacaatctggcgcggcgttatggcctgagc
cgtgaaactgtggatgcttacgcctgcgacagccatcggcgggcgctggcggcgcagcaa
acgggctggctggcgccggagatcgtggccgtaggtcatcagactttcgacctggacggt
taccagccgcgcggcatcaccttgccacgtggggtcgatactgtgagtgaagacagccat
ccacggcctgctgagctggcggccttggcccgactgcgtgcggtgcaccaaggcggggtg
cagaccgccggcaacagctgtgcggtggtcgatggcgcggcggcggcgctggtcgcccgc
acttcggcctgccgggatacgccattggccctgctgcgggccagcgccgtggtcggggtg
gcgcctgagttcatgggtataggtccggcaccggcgatccgcctgctgttgcaacgcagc
ggcctggagctgaatcaaattggccgttacgaaatcaacgaagcccaggccgcccaagtg
ctggccgtggcacaggaattggaactggaccactcgcgtctcaacgttcagggcggttcg
ctggctctgggtcacccgctggctgccagtggtttgcgcctggtgctgaccttggcccgt
cagctgcgcgagcacaacctgcgctacgggattgcagcggcctgtgtcggcggcgggcag
ggcatggccttgttgatcgagaatccgggctggtgcgcctga

DBGET integrated database retrieval system