KEGG   Pseudomonas fragi: AV641_18565Help
Entry
AV641_18565       CDS       T04285                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
pfz  Pseudomonas fragi
Pathway
pfz00051  Fructose and mannose metabolism
pfz00520  Amino sugar and nucleotide sugar metabolism
pfz01100  Metabolic pathways
pfz01110  Biosynthesis of secondary metabolites
pfz01130  Biosynthesis of antibiotics
pfz02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:pfz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AV641_18565
   00520 Amino sugar and nucleotide sugar metabolism
    AV641_18565
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    AV641_18565
Enzymes [BR:pfz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     AV641_18565
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     AV641_18565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3 AraC_binding
Motif
Other DBs
NCBI-ProteinID: AMB80936
UniProt: A0A109R935
Position
4134770..4136221
Genome map
AA seq 483 aa AA seqDB search
MIPVILSGGSGSRLWPLSRKQFPKQFLALTGEQTLFQQTLERLVFEGMQAPIVVCNKDHR
FIVNEQLANRRLETQRILMEPFGRNTAPAVALTAMMLINEGRDELMLVLPADHVLEDQKA
LQRALALATVAAERGEMVLFGVPALKPETGYGYIKSAADGLLPEGVSRVASFVEKPDAKR
AAEFVKSGGYFWNSGMFLFRASRFLEELKQHEPDIYDTCVLTLERSQQDVDTIDIDDATF
ACCPDNSIDYAVMEKTLRACVVPLTAGWSDVGCWSSLWDVNEKDVNGNVCKGDVVIQDST
NCMIHGNGKLVSVIGLDSIVVVETKDAMMIAHKDKVQGVKQMVNTLNKQGRSETQNHCEV
YRPWGSYDSVDMGGRFQVKHISVKPGACLSLQMHHHRAEHWIVVSGTAEVTCDENVFLLT
ENQSTYIPIASVHRLRNPGKIALEIIEVQSGSYLGEDDIERFEDVYGRSTPVGRGVSIKT
IAQ
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgattccggtaattctttctggtggtagcggttcgcgtctgtggcctttgtcgcgcaag
cagtttcccaagcagtttctggccctgaccggcgagcagaccctgttccagcaaaccctc
gaacgcctggtattcgaaggcatgcaggcgccgatcgtggtgtgcaacaaagaccaccgt
tttatcgtcaatgagcaattggccaaccgcaggctcgagacccagcgcatcctcatggaa
cctttcgggcgcaacaccgcgcctgccgtggcgttgacggcgatgatgctgatcaatgaa
ggccgcgacgagttgatgctggtactgcccgccgaccacgtactggaagaccagaaagcc
ctgcaacgggcgctggccctggccaccgtggccgccgagcgcggcgaaatggtgttgttc
ggcgtgccggccctcaagcccgaaaccggctatggctatatcaagtccgcagccgacggc
ttactgcccgaaggcgtcagccgggtcgcatccttcgtcgaaaaacctgatgccaaacgc
gctgccgagtttgtcaaaagcggcggctatttctggaacagcggcatgtttctgttccgc
gccagccgctttctcgaagagctcaaacagcatgagccggatatctatgacacctgtgtg
ctgaccctggagcgcagccagcaggatgtcgacaccatcgacatcgacgacgccaccttc
gcctgctgcccggacaactccatcgactatgccgtgatggaaaaaaccctgcgcgcctgt
gttgtcccgctgaccgcaggctggagtgacgtgggctgctggtcatcgctgtgggacgtc
aatgaaaaagacgtcaacggcaacgtctgcaagggcgatgtggtcattcaggacagtacc
aactgcatgatccacggcaacggcaaactggtatcggtgatcggtctggacagcattgtg
gtggtggaaaccaaagacgcaatgatgatcgcccacaaggacaaggttcagggggtcaaa
cagatggtcaacaccctgaacaaacaaggccgcagcgaaacccagaaccactgcgaggtc
tatcgtccgtggggctcctatgactcggtggacatgggcgggcggttccaggtcaaacat
atttcggtcaagcccggcgcctgcctgtcgctgcaaatgcaccaccaccgcgccgagcac
tggatcgtggtttcgggcacggcagaggtgacctgcgacgagaacgtgttcctgctcacc
gaaaaccagtcgacctatatcccgattgcctcggtccaccgcctgcgcaacccggggaaa
atcgccctggaaatcatcgaagtgcagtccggcagctatctgggcgaagacgacatcgag
cgctttgaagatgtatacggacgctcgacgccagtgggccgtggcgtgtcgatcaagacc
atcgcccagtag

DBGET integrated database retrieval system