KEGG   Pseudomonas fragi: AV641_22545Help
Entry
AV641_22545       CDS       T04285                                 

Definition
(GenBank) pyruvate carboxylase subunit A
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
pfz  Pseudomonas fragi
Pathway
pfz00020  Citrate cycle (TCA cycle)
pfz00620  Pyruvate metabolism
pfz01100  Metabolic pathways
pfz01120  Microbial metabolism in diverse environments
pfz01200  Carbon metabolism
pfz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pfz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AV641_22545
   00620 Pyruvate metabolism
    AV641_22545
Enzymes [BR:pfz01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     AV641_22545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp RimK ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AMB81658
UniProt: A0A109R9L8
Position
complement(5027393..5028808)
Genome map
AA seq 471 aa AA seqDB search
MIKKILIANRGEIAVRIVRACAEMGIRSVAVYSEADRHALHVKRADEAHSIGEDPLAGYL
NPRKLVNLAVETGCDALHPGYGFLSENAELADICAERGIKFIGPSAEVIRRMGDKTEARR
SMIKAGVPVTPGTEGNVADIHEALIEGERIGYPVMLKATSGGGGRGIRRCNSREELEQAF
PRVISEATKAFGSAEVFLEKCIVNPKHIEAQILGDSFGNVVHLFERDCSIQRRNQKLIEI
APSPQLTPEQRAYIGDLSVRAAKAVGYENAGTVEFLLAEGEVYFMEMNTRVQVEHTITEE
ITGIDIVREQIRIASGLALSIKQEDIHHRGFALQFRINAEDPKNNFLPSFGKITRYYAPG
GPGVRTDTAIYTGYTIPPYYDSMCLKLVVWALTWEEAMDRGLRALDDMRLQGVKTTAAYY
QEILRNPEFRSGQFNTSFVESHPELTNYSIKRKPEELALAIAAAIAAHAGL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgataaaaaagatcctgatcgccaaccgcggagaaattgccgtccgcatcgtgcgtgcc
tgcgccgagatgggtatccgctctgttgcggtctattccgaagctgaccggcatgccttg
cacgtcaagcgcgccgatgaagcgcacagcattggcgaagacccgctggccggctatctc
aacccgcgcaagctggtgaacctggccgttgaaaccggttgtgatgccttgcatcccggt
tacggttttctgtcagaaaatgccgaactggctgacatttgcgccgagcgcggaatcaag
ttcattggtccgtccgctgaagtcattcgccgcatgggcgacaagaccgaagcgcgccgc
agcatgatcaaggccggtgtgccggttactccgggcactgagggcaacgttgccgatatc
cacgaagcactgatcgaaggcgagcgcatcggttacccggtgatgcttaaagccacatcg
ggtggcggcggtcgcgggattcgtcgttgcaacagccgcgaagagcttgaacaggcattc
ccccgggttatctccgaagccaccaaagcctttggctcggctgaagtgtttctcgaaaaa
tgcatcgttaaccccaagcacatcgaggcgcagattctcggcgacagtttcggcaacgtg
gtgcatctgttcgagcgtgattgctcgatccagcgccgcaaccagaagctgatcgaaatc
gccccaagcccgcagttgaccccggagcagcgcgcctacatcggcgacctgtccgtgcgc
gcagccaaggcggtgggttacgagaacgccggtaccgtggagttcctgctcgccgagggc
gaggtgtacttcatggagatgaatacccgggtgcaggtcgaacacaccatcaccgaagaa
atcaccggcatcgacattgttcgcgaacaaattcgcatcgcctccggcctggccctgtcg
atcaagcaggaagacattcatcaccgcggctttgccctgcaattccggatcaatgccgaa
gatccgaaaaacaatttcctgcccagcttcggcaagatcacccgttactacgcgcccggc
gggcctggcgtgcgtactgacacggcgatctataccggttacaccattcccccgtattac
gactccatgtgtctgaaactggtggtgtgggcgctgacctgggaagaagcgatggaccgt
ggtttgcgcgccctcgacgatatgcgtctgcagggggtcaaaaccaccgccgcctattac
caggaaattctgcgtaacccggaattccgtagtggccagttcaataccagcttcgtagaa
agccaccctgaactgaccaactattcgatcaagcgcaaacccgaagagctggccctggcc
atcgccgccgccattgccgcccacgcaggcctgtga

DBGET integrated database retrieval system