KEGG   Phaeobacter inhibens DSM 17395: PGA1_c03750Help
Entry
PGA1_c03750       CDS       T02192                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00020  Citrate cycle (TCA cycle)
pga00190  Oxidative phosphorylation
pga00650  Butanoate metabolism
pga01100  Metabolic pathways
pga01110  Biosynthesis of secondary metabolites
pga01120  Microbial metabolism in diverse environments
pga01130  Biosynthesis of antibiotics
pga01200  Carbon metabolism
Module
pga_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pga_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pga_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PGA1_c03750 (sdhD)
   00650 Butanoate metabolism
    PGA1_c03750 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    PGA1_c03750 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AFO90109
UniProt: I7DXC4
Position
359778..360149
Genome map
AA seq 123 aa AA seqDB search
MRYLTDRKRAVGMGAAKSGTAHHWSMQVSSIGLLILVPLFVFTFGSALGGSYEEITAYYA
RPFPALVALLTIWVGMMHFKSGAQIMIEDYVHGFAGRLTIILVTCLSYAVAAVSAYALIR
LAL
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgcgttatttgacagatcgcaagcgtgccgttggcatgggtgctgcgaaatccggtaca
gcacatcactggtcgatgcaggtcagctccatcgggttgctgatcctggtgcccctgttc
gtctttacctttggctcggcgctgggcggatcctacgaagagatcaccgcctattacgcg
cgcccgtttcctgcacttgttgcactgctgaccatctgggtcggcatgatgcacttcaaa
tccggtgcgcagatcatgatcgaagactatgtccatggctttgccggtcgtctgacgatc
attctggtcacctgtctgtcttatgccgtggccgcggtcagcgcctatgcgctgatccgc
ctggcgctgtaa

DBGET integrated database retrieval system