KEGG   Phaeobacter inhibens DSM 17395: PGA1_c04610Help
Entry
PGA1_c04610       CDS       T02192                                 

Definition
(GenBank) haloacid dehalogenase, type II
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00361  Chlorocyclohexane and chlorobenzene degradation
pga00625  Chloroalkane and chloroalkene degradation
pga01100  Metabolic pathways
pga01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pga00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PGA1_c04610
   00361 Chlorocyclohexane and chlorobenzene degradation
    PGA1_c04610
Enzymes [BR:pga01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     PGA1_c04610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase HAD_2 Hydrolase_like Hydrolase_6 HAD
Motif
Other DBs
NCBI-ProteinID: AFO90195
UniProt: I7EWJ8
Position
complement(454421..455107)
Genome map
AA seq 228 aa AA seqDB search
MAITTCIFDAYGTLFDVTAAARQAAQEPEFPHLIDHWAELANHWRLKQLQYTWLRAITNA
HTDFWQVTQDGLDWAMEATGLSGDPQLRKRLLDLYWQLQAYEEVPEMLRTLKAAGLQTAI
LSNGSPKMLEGAVNSAGVSGLLDDVLSVEAVGVFKPAAQVYDLVEARFSCQRDEVLFVSS
NGWDAAGAAGYGFTTAWVNRGGEPMDRLPWTPHHVLSDLSSIPKLLDT
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcacaacctgtatcttcgatgcctatggcacattgttcgacgtgacagcggca
gcacgacaggctgctcaggagccggagttcccgcatctgatcgaccattgggccgagctg
gccaaccattggcgactgaaacaactacaatacacctggctacgcgccatcaccaatgcc
cacacggatttctggcaggtcactcaagacggattggactgggcaatggaagccaccggc
cttagcggggatcctcagctacgaaaacggttactcgatctctattggcaacttcaggcc
tatgaggaagtgccggagatgctgcgcacgctcaaagcggctggtctgcagacagccatc
ctgtccaatgggtcacccaaaatgcttgaaggcgcagtaaactccgccggtgtgagcggg
cttctcgacgatgtcttatcggtggaggccgtcggagtgttcaaacccgctgcacaggtc
tacgacctcgtggaggcccggttcagctgtcagcgcgacgaggttttgtttgtttcctcc
aacggctgggacgccgccggggcggcggggtatggatttaccacagcctgggtcaatcgt
ggtggcgaaccaatggatcgtctgccctggacgccacatcatgtgttgagcgatctgagc
agtatcccgaaattgcttgatacatag

DBGET integrated database retrieval system