KEGG   Phaeobacter inhibens DSM 17395: PGA1_c12950Help
Entry
PGA1_c12950       CDS       T02192                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase Acs
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00010  Glycolysis / Gluconeogenesis
pga00620  Pyruvate metabolism
pga00640  Propanoate metabolism
pga00680  Methane metabolism
pga01100  Metabolic pathways
pga01110  Biosynthesis of secondary metabolites
pga01120  Microbial metabolism in diverse environments
pga01130  Biosynthesis of antibiotics
pga01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGA1_c12950 (acs)
   00620 Pyruvate metabolism
    PGA1_c12950 (acs)
   00640 Propanoate metabolism
    PGA1_c12950 (acs)
  Energy metabolism
   00680 Methane metabolism
    PGA1_c12950 (acs)
Enzymes [BR:pga01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PGA1_c12950 (acs)
Lipid biosynthesis proteins [BR:pga01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PGA1_c12950 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFO91012
UniProt: I7EW52
Position
complement(1338656..1340743)
Genome map
AA seq 695 aa AA seqDB search
MDTYFLIFKLGYYRCGGRKWFDTSRCALWCAIPRTDWREGHKMTQESDSKAYAPSEETVA
RAHVNAAQYDEMYAASMQDPEGFWRQQAERIDWIKPFTQVKDVDFTLGNVSINWYADGTL
NVAANCIDRHLDTRGDQTAIIWEPDSPDEAAQHISYKQLHTRVCRMANVLETMGVRKGDR
VVIYLPMIPEAAYAMLACARIGAIHSIVFAGFSPDALAARVNGCDAKVLITADEAPRGGR
KTPLKSNADAALLHTKDTVKCLVVKRTGGQTTWIDGRDYDYNEMALEADDYSKPAEMNAE
DPLFILYTSGSTGQPKGVVHTTGGYLTYAAMTHEITFDYHDGDIYWCTADVGWVTGHSYI
VYGPLANGATTLMFEGVPTYPDASRFWQVCDKHKVTQFYTAPTALRALMGQGNEWVEKCD
LSSLRTLGTVGEPINPEAWNWYNDIVGKGKCPIVDTWWQTETGGHLMTPLPGAHATKPGA
AMKPFFGVAPVVLDPQSGEEITGNGVEGVLCIKDSWPGQMRTVWGDHERFEKTYFSDYKG
YYFTGDGCRRDEDGDYWITGRVDDVINVSGHRMGTAEVESALVAHAAVAEAAVVGYPHEI
KGQGIYCYVTLMNDREPSDELVKELRTWVRTEIGPIASPDVIQWAPGLPKTRSGKIMRRI
LRKIAENDFGSLGDTSTLADPSVVDDLIANRADKG
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggacacttatttccttattttcaagcttgggtattatcgctgcggaggacggaaatgg
tttgacacatctcgctgtgcgctgtggtgtgccattccgagaacagactggagggaggga
cacaagatgacccaggagagcgacagcaaagcctatgcgccgtcggaggagacggttgcg
cgtgcccatgttaacgccgcacaatatgatgagatgtacgccgcttctatgcaggatcca
gagggtttctggcgtcagcaggcggagcggatcgactggatcaaacccttcacccaagtg
aaggacgtggacttcacgctcggtaatgtctcgatcaactggtacgcagacggcacgctg
aatgtcgccgccaactgcatcgaccgccaccttgacacccgcggcgatcagacggcgatc
atctgggagcccgacagccccgatgaggctgcacagcacatttcttacaagcagctccac
acccgtgtctgccgtatggccaacgtcctggagaccatgggcgtgcgcaaaggggatcgc
gtggtgatctacctgccgatgatccccgaagccgcctatgccatgctggcctgcgcccgt
atcggcgcaattcactccattgtctttgccggtttctcgccagatgccctggcggcgcgg
gtcaatggctgcgatgccaaggtcctcatcaccgcggatgaggccccccgtggtggccgc
aagaccccgctgaaatccaacgccgacgccgcgctcctgcacaccaaggacactgtgaaa
tgcttggtggtcaagcgcaccggcggccagaccacgtggatcgacggacgcgactatgac
tacaacgaaatggcgttggaggcggacgactactccaaacccgcagaaatgaacgccgag
gacccgctattcatcctctacacctccggctccaccggccagcccaagggggttgtacac
accaccggcggctacctgacctatgccgcgatgacgcatgagatcacctttgattatcat
gacggcgacatctactggtgtacggcggatgtgggctgggtaaccggccacagctatata
gtctatgggccgctggccaatggtgccaccacgctgatgttcgaaggcgtgccgacctac
ccggacgccagccggttctggcaggtctgcgacaagcataaggtgacgcagttctacacc
gcccccactgcactgcgcgccctgatgggtcagggcaacgaatgggtcgaaaaatgcgat
ctgtcctccctgcgcacccttggcaccgtgggcgagccgatcaatcccgaagcctggaac
tggtacaatgatatcgtcggcaaaggaaaatgtcctattgtcgacacgtggtggcagacc
gaaaccggtggtcatctgatgacccccctgcccggtgcccatgcaaccaagcccggtgcg
gcgatgaagcccttctttggcgtggctcccgtggttctggacccgcagtccggcgaggaa
atcaccggcaacggcgtcgaaggtgtgctctgcatcaaggacagctggcccggccagatg
cgcaccgtctggggcgaccatgagcggttcgagaagacgtatttctcggactacaaaggc
tactacttcaccggtgatggctgccgtcgcgacgaggacggcgactattggatcactggc
cgcgtcgatgacgtgatcaatgtctccggtcaccgcatgggcacagccgaggtcgaaagc
gcccttgtggctcacgccgccgtcgcggaggccgctgtggtcggctacccgcatgagatc
aagggccagggcatttattgctatgtcaccctgatgaacgaccgcgaaccgtcggatgag
ctggtgaaggagctgcgcacctgggtccggacggagatcggcccgattgcctctcctgat
gtaattcaatgggcgccgggtctgccgaaaacccgctccggcaagattatgcgccgcatt
ctgcgcaagattgcggagaatgattttggcagccttggtgacacctcaaccctcgccgat
ccgtcggtggtggatgatctgatcgcaaaccgagccgacaaaggatga

DBGET integrated database retrieval system