KEGG   Phaeobacter inhibens DSM 17395: PGA1_c13780Help
Entry
PGA1_c13780       CDS       T02192                                 

Gene name
dltA2
Definition
(GenBank) D-alanine--poly(phosphoribitol) ligase subunit
  KO
K03367  D-alanine--poly(phosphoribitol) ligase subunit 1 [EC:6.1.1.13]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00473  D-Alanine metabolism
pga01100  Metabolic pathways
pga01503  Cationic antimicrobial peptide (CAMP) resistance
pga02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pga00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PGA1_c13780 (dltA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    PGA1_c13780 (dltA2)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    PGA1_c13780 (dltA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:pga01504]
    PGA1_c13780 (dltA2)
Enzymes [BR:pga01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     PGA1_c13780 (dltA2)
Antimicrobial resistance genes [BR:pga01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    PGA1_c13780 (dltA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFO91092
UniProt: I7EWC7
Position
1423445..1425016
Genome map
AA seq 523 aa AA seqDB search
MFETFIADLRETLLSQLDRPALITSEEVISFGSLAGRVEGILRALDDMPPGLSLIVGHKE
PDCIAAMIACAIAGRAFAFADRSTPMDRLEQIASTAGASHILAFGQETLPGGLPVQTLKE
LPTRTPQLELKTALSEEGTFYVIFTSGSTGTPKGVPISRGNYMALHRWYTPLLGAVRPEG
AHVNHASMAFDMGMFDLWPTLSLGRPVHLLNHANNIMPRNNIRHLTRVDVASPASWASTP
SLLQLMCTDPQFTAENLPDLRFFVVGGEMLPGALVQELQTRFPQAQVLNGYGPSEATCAT
HLYPISVADAAADGPMKIGCAVGENRMQIIDADGEDVPAGEEGELVLSGPQVISHYLPQD
HPANAALSQESGINTYRTGDLARLDVDGNLILLGRIDRQVKLLGNRIELNEIERIAEGYS
AVRKAVCLPQKDAAGRVTGLQLFVEPLAGATCERDGLFAHMGKHLSAQVLPRDLRIVSAF
PVTSNGKLDTRILLEGGSDLPTALPPSRDIVASDTGLMAESVK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagacatttattgcagacctccgtgaaaccctgctttcgcaactggaccgcccg
gcattgatcacctctgaggaggtgatcagttttggcagcttggctggccgggttgaaggc
atcctgcgcgcgctcgacgatatgccgccggggctcagcctgattgtcggccataaggaa
ccggattgcattgccgcgatgattgcctgcgccattgctgggcgcgcttttgcctttgcc
gaccgctccacgccgatggaccgtttggagcagatcgccagcaccgccggggccagtcat
attttggcctttggccaggaaaccctgccaggtggtttgccggtccagacgttaaaggaa
ctgccgacacgcacgcctcagctggaattgaaaaccgcgctctctgaggagggaaccttc
tatgtgattttcacctccggcagtaccggcacgccaaagggggtgccgatttcacggggc
aactatatggcgctgcaccgttggtatacgccgctactgggggctgtcaggccagagggc
gcgcatgtgaaccatgccagcatggcctttgacatgggcatgtttgatctctggccaacc
ctgtctctggggcgtcccgtgcatttgctcaaccatgcaaacaacattatgccccgcaac
aacatccgtcatctgacccgcgttgatgtggcctctccggcgtcttgggcgtcgacccct
tcgctgctgcaactgatgtgcacggacccgcagttcaccgctgaaaacctgccggatctg
cgcttttttgtggtcggcggtgagatgttgccgggtgcgctggtccaggaactacagacc
cgctttccgcaggctcaggtactgaatggctatggcccgtccgaggccacttgtgcgacc
catctctacccgatcagcgtcgcagatgctgcagcagatggcccgatgaaaatcggctgc
gcggttggggaaaaccggatgcagatcatcgacgcagacggtgaagatgttcccgcaggg
gaggaaggcgagctggtcttgtccggcccgcaggttatcagccactatttgccgcaggat
catcccgccaatgcagcgcttagccaagaaagcggcatcaatacttatcgcacaggtgat
ctcgcccgtcttgatgtggatggaaatctgatcttgttgggccggatcgaccggcaggtc
aaacttctaggcaaccggatagaattgaacgaaatcgagcgtatcgccgaaggctactca
gctgtacgcaaagctgtctgcctgccgcaaaaagacgccgccggccgcgtcaccgggttg
cagctctttgtagagcctctggccggggccacctgtgaacgggatggcttgtttgcccat
atgggcaagcatctctcggcgcaggtgctaccgcgtgatctgcggattgtgtcggctttt
ccagtgaccagcaatggcaagctggacacgcgcatcctgcttgagggcggatcggatctg
ccgacagcactgcccccctcgcgcgacatcgtggcatctgacactggtttgatggcggag
tctgtgaaatga

DBGET integrated database retrieval system