KEGG   Phaeobacter inhibens DSM 17395: PGA1_c16470Help
Entry
PGA1_c16470       CDS       T02192                                 

Gene name
cysS
Definition
(GenBank) cysteinyl-tRNA synthetase CysS
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pga00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    PGA1_c16470 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pga01007]
    PGA1_c16470 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pga03016]
    PGA1_c16470 (cysS)
Enzymes [BR:pga01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     PGA1_c16470 (cysS)
Amino acid related enzymes [BR:pga01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   PGA1_c16470 (cysS)
Transfer RNA biogenesis [BR:pga03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    PGA1_c16470 (cysS)
 Prokaryotic type
    PGA1_c16470 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 DALR_2 tRNA-synt_1f tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AFO91351
UniProt: I7DQL8
Position
complement(1708087..1709484)
Genome map
AA seq 465 aa AA seqDB search
MTTIKLHNTRTRGKEVLNPINPDDVRLYLCGPTVYDRAHLGNARPVVVFDVLYRLLRHVY
GTDHVTYARNFTDVDDKINATALARKEAGAPGTLEELVQERTEETISWYLADMAELGALE
PDHMPRATAYIPQMIAMIEELIAKGHAYADGAGHVLFSVKSYKDYGALSGRSVDDMIAGA
RVEVADNKRDPMDFVLWKPSTDELPGWDSPWGRGRPGWHIECSAMSHELFGDSFDIHGGG
NDLMFPHHENEIAQSCCAHPEGDFAKIWLHNEMLQVEGKKMSKSLGNFFTVRDLLDQGYP
GEVIRLVFLQTHYRKPMDWTDKKAKEAEATLRKWYQLAATALDNEEPYVGVINALSDDLN
TAQAIAELHQLFHAGDAASMRASLKFMGLMGADTPTWATGENIDLTLYERKLSDAREVAM
QSKDFSEVDRLKAAFVAAGVEVRMSKTGVELVPGPSFDSSKLDAI
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgatcaagctgcacaacacccgcaccagaggcaaagaggtgctgaacccgatc
aatcccgacgatgtgcgcctctatctctgcgggccgacagtctatgaccgcgcccatctg
ggcaatgcgcgcccggtggtggtgtttgatgtgctctatcgcctgttgcgccatgtctac
ggcaccgatcacgtcacctatgcgcgcaatttcaccgatgtggatgacaagatcaacgca
accgcgctggcccgcaaggaagcaggcgcgccgggcacgctggaagagctggtacaggag
cgcacagaggagactatcagttggtatctggcggatatggctgaactgggcgcgctggag
ccggatcatatgccgcgcgcaaccgcctatatcccgcagatgatcgcgatgatcgaagag
ctgatcgccaagggccatgcctatgcggacggtgccggtcatgtgctgttctcggtcaag
agctacaaggattacggcgcgctgtccggccggtcggtggacgacatgattgccggtgcg
cgggttgaagtggcggataacaaacgcgatccaatggatttcgtgctgtggaagccctcc
accgatgagctgcccggttgggacagcccctggggccggggtcgtccgggctggcatatc
gaatgctccgccatgagccacgagctgtttggcgatagtttcgacattcacggcggcggc
aatgacctgatgttcccgcatcacgagaatgaaattgcgcaaagctgctgtgcccatccc
gagggtgattttgcaaaaatctggctgcataatgagatgctgcaggtcgaaggaaagaag
atgtccaagtctctgggcaactttttcaccgtgcgcgacctcttggatcaggggtatccg
ggggaggtgatccggttggtatttttgcaaacccactatcgcaagccgatggattggacc
gacaaaaaagcaaaagaagcagaggcaacgctgcgtaagtggtatcagcttgcggcaacg
gccctagacaatgaagaaccatatgttggggtgatcaatgcactatccgatgatctaaat
acagcccaagcaattgccgaattgcatcagctttttcatgccggagatgctgcaagcatg
cgggctagtttgaagttcatgggtcttatgggtgcggacactccaacatgggctaccggt
gagaacattgatctaaccttatatgagagaaaactatccgatgctcgggaagtcgctatg
cagagtaaggatttttccgaggttgatcgcctgaaggcggcctttgttgctgctggggtt
gaggtccggatgagtaagaccggcgttgaactggtgcccggcccctcattcgattccagc
aaactggacgcgatctag

DBGET integrated database retrieval system