KEGG   Phaeobacter inhibens DSM 17395: PGA1_c24210Help
Entry
PGA1_c24210       CDS       T02192                                 

Definition
(GenBank) putative phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
pga  Phaeobacter inhibens DSM 17395
Brite
KEGG Orthology (KO) [BR:pga00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    PGA1_c24210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF1129
Motif
Other DBs
NCBI-ProteinID: AFO92106
UniProt: I7DSQ8
Position
2525591..2527072
Genome map
AA seq 493 aa AA seqDB search
MSDAPQRPQWKTLDRDLNRISQLELATSYVSRPLVAPGIALVFIALAGVGAAVFLGSAPS
NFVVIAAAAFGAYMALNIGANDVANNMGPAVGANALTMGGAIVIAALAESAGALLAGGDV
VSTISKGIIDPAGVASSEVFIWAMMAALISSALWVNLATWIGAPVSTTHSVVGGVMGAGI
AAAGFGAVNWPTMSKIAASWVISPVLGGLIAAGFLAFIKAKIIYQDDKIAAARRWVPVLV
GIMAGAFASYLALKGLKRIIKIDLEIALLIGAAVGGLSYVVTAPLIKRQSEGMENRNKSL
KVLFSIPLVISAALLSFAHGANDVANAVGPLAAIVHTTEFGDIASKVAIPTWVMVIGAFG
ISFGLFLFGPKLIRMVGSQITKLNPMRAYCVSLSAAITVIVASWLGLPVSSTHIAVGAVF
GVGFFREWHMERRLKRSSATQPETKRIAPEERRRRKLVRRSHFMTIAAAWVITVPAAALL
SGCVFLALTAITM
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgcaccgcagcgaccgcagtggaagacactggaccgggaccttaaccggatt
tctcaacttgaactggcgacatcctatgtgtcgcgtccgctggttgcccccggcatcgcg
ctggtcttcattgccctcgccggtgtcggtgcagcggtgttcctcggctcggcgccgtca
aacttcgtggtgatcgccgcggcggcatttggcgcatatatggcgctgaacatcggcgcc
aatgacgtggccaacaatatgggtcctgcggtgggtgccaatgcgctgaccatgggcggg
gccatcgtgattgctgccttggctgaaagtgccggtgcgctgctggcgggcggcgatgtg
gtctctaccatctccaagggcatcattgatccggcgggcgttgccagctccgaagtgttc
atctgggcgatgatggcggcgctgatttcttcggcgctgtgggtgaacctcgcgacatgg
atcggcgcgcctgtctcaaccacacattcggttgtgggcggtgtcatgggggcaggcatt
gccgctgccgggtttggtgctgtgaactggcccacgatgagcaaaatcgctgccagctgg
gtcatctcccccgtattgggcgggctgattgcggccgggttcctcgccttcatcaaggcc
aagatcatctatcaggacgacaagatcgccgccgcgcgccgctgggtgccggtgctggtc
ggcatcatggcaggggcgtttgcctcttatctggcgctaaagggcctgaagcggatcatc
aagattgatctggaaattgcgctgctgatcggtgccgcggttggcgggctatcctatgtg
gtgaccgcgccgctgatcaagcgtcaatccgagggtatggagaaccgcaacaaatcgctg
aaagtgctgttctcgatcccactggtgatttctgccgcgcttctgtcgtttgctcatggc
gccaatgatgtggccaatgcggtgggtccgctggcagcgattgtgcataccaccgagttt
ggcgatatcgcctccaaggtggcgatcccgacctgggtcatggtgatcggggcctttggc
atctcattcggcctgttcctgttcggccccaagctgatccgcatggttggcagccagatc
accaaactgaaccccatgcgcgcctattgtgtgtcgctgtccgccgcgatcaccgtgatt
gttgcaagctggctgggtctgcccgtgtcctccacccatattgcggtgggggctgtgttt
ggcgtgggcttcttccgtgaatggcatatggagcgccgcctgaagcgcagctcggctacg
cagcctgaaaccaagcggattgccccggaagagcgccgtcgtcgcaagctggtgcgccgc
agccatttcatgacaattgctgccgcctgggtaatcaccgtgcccgccgccgccttgctg
tcgggctgtgtcttcctggcgttgaccgcgatcaccatgtga

DBGET integrated database retrieval system