KEGG   Phaeobacter inhibens DSM 17395: PGA1_c24340Help
Entry
PGA1_c24340       CDS       T02192                                 

Gene name
algC
Definition
(GenBank) phosphomannomutase/phosphoglucomutase AlgC
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga00010  Glycolysis / Gluconeogenesis
pga00030  Pentose phosphate pathway
pga00051  Fructose and mannose metabolism
pga00052  Galactose metabolism
pga00230  Purine metabolism
pga00500  Starch and sucrose metabolism
pga00520  Amino sugar and nucleotide sugar metabolism
pga00521  Streptomycin biosynthesis
pga01100  Metabolic pathways
pga01110  Biosynthesis of secondary metabolites
pga01120  Microbial metabolism in diverse environments
pga01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PGA1_c24340 (algC)
   00030 Pentose phosphate pathway
    PGA1_c24340 (algC)
   00051 Fructose and mannose metabolism
    PGA1_c24340 (algC)
   00052 Galactose metabolism
    PGA1_c24340 (algC)
   00500 Starch and sucrose metabolism
    PGA1_c24340 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PGA1_c24340 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PGA1_c24340 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PGA1_c24340 (algC)
Enzymes [BR:pga01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PGA1_c24340 (algC)
    5.4.2.8  phosphomannomutase
     PGA1_c24340 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_II PGM_PMM_I PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: AFO92119
UniProt: I7E2Y8
Position
2539364..2540860
Genome map
AA seq 498 aa AA seqDB search
MTKPIPEVRPNTWSFLRDPMITPTGFREYDARWKYPEEINLPGMTALGLGLGTQMHKRGI
PPVIAVANDYRDYSVAIKHALIIGLMQAGIEVRDIGPALSPMAYFAQFHLDVPAVAMVTA
SHNPNGWTGVKMGFERPLTHGPDEMGELRDIVLNGEGVARPGGSYQFVDGVKEAYLDDLV
GDFKMSRPLKVVCATGNGTASAFAPELFERMGVEVVDSHNALDYTFPHYNPNPEAMEMLH
DMSASVKASGADMALGFDGDGDRCGVVDDEGEEIFADKVGVIMARDLSKLYPNSTFVADV
KSTGLFASDPELKANGVTADYWKTGHSHMKRRVKEIGALAGFEKSGHYFLAEPVGRGYDC
GMRVAVEICKLMDRNPDKSMSDLRKALPKTWATPTMSPYCADTEKYTVLERLVAKLVAKA
EAGETLADRPIKEVVTVNGARVILDNGSWGLVRASSNTPNLVVVCESSESEAELREIFAE
IDAVIRTEPLVGEYDQTF
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaacccatccccgaggtgcgcccgaacacctggagctttctgcgcgatccgatg
atcacgcccaccggttttcgcgaatatgacgcgcgctggaaataccctgaggaaatcaac
ctgcccggcatgaccgcgctggggctgggactgggcacccagatgcacaagcgtggcatc
ccgccggtgatcgcagtggcgaatgattaccgcgactattcggtcgccatcaaacacgcg
ctgatcatcggcctgatgcaggcgggtatcgaagtgcgcgatatcggcccggccctgtca
cccatggcctatttcgcccagttccatctggatgtgcctgccgtggccatggtgaccgcc
agccacaacccgaacggctggaccggggtcaagatgggctttgaacgcccgctgacccac
ggcccggacgaaatgggtgagctgcgggacattgtcctgaatggtgagggtgtcgcccgt
cccggcggttcctatcagttcgtggatggcgtgaaagaggcctatctcgatgatctggtc
ggcgatttcaaaatgtcccgcccgctaaaggtggtctgcgccaccggcaatggcaccgcc
tcagcctttgcgccggagctgttcgaacggatgggggtggaggtggtcgatagccacaat
gcgctggactataccttcccacactacaacccgaaccccgaagccatggaaatgctgcac
gatatgtctgccagcgtaaaagcctctggcgccgatatggcgctggggtttgatggcgat
ggcgatcgttgcggcgtggtggatgatgagggcgaagagatctttgccgataaggttggc
gtcatcatggcgcgggatctgagcaagctttacccgaattcgacctttgtcgcagatgtg
aaatccaccgggctgtttgcctctgatcccgagctgaaggccaatggcgtgacggcggac
tattggaaaaccggtcacagccacatgaaacggcgggtgaaggagatcggcgcgctggcg
ggatttgaaaagtccggccactatttcctcgctgaacctgtgggccggggctatgactgc
ggcatgcgggtcgcggtcgagatctgcaagctgatggaccgcaaccccgacaagagcatg
tccgacctgaggaaagcgctgcccaagacctgggcgaccccaaccatgtcgccctattgc
gccgacaccgagaaatacaccgtgctggagcgcctggtggcaaagctggtcgccaaggcc
gaggcgggtgagacgctggcagaccgccccattaaggaggtcgtcaccgtgaatggggcg
cgtgtaatccttgataacgggtcttggggattggtgcgggcatcgtctaatacgcccaac
ctcgtcgtggtttgcgaaagcagcgagagcgaggcggaactgcgcgagatctttgccgag
attgacgcggtgatacgcaccgaaccgctggtcggtgaatatgatcagaccttctga

DBGET integrated database retrieval system