KEGG   Phaeobacter inhibens DSM 17395: PGA1_c30190Help
Entry
PGA1_c30190       CDS       T02192                                 

Gene name
cycM
Definition
(GenBank) cytochrome c-552
  KO
K08738  cytochrome c
Organism
pga  Phaeobacter inhibens DSM 17395
Pathway
pga02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pga00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PGA1_c30190 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 DUF1476
Motif
Other DBs
NCBI-ProteinID: AFO92674
UniProt: I7E4G0
Position
complement(3157850..3158353)
Genome map
AA seq 167 aa AA seqDB search
MFDTMTLTKATAGVCGAFLVFLLGKWAAEELYHTESHGEASYVIEVEEAGAEEVAEVVDF
GELMAAADVGKGAKVFKKCSACHKLEAGENATGPYLYGVVDRPIAAADGFGYSATLAGLG
GEWTAEELDAFLTKPSQYAPGTTMSFSGLKKQKDRVNLIAYLDSLDD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacacgatgacccttaccaaagcgaccgcaggcgtttgcggcgcgttcctcgtg
ttcctcctgggcaaatgggccgcagaggaactctatcatactgaaagccacggcgaggct
tcttatgtgattgaagtggaagaggcaggtgcggaagaagttgctgaagtcgtagacttc
ggcgaactgatggccgcagcagatgttggcaaaggtgccaaggtcttcaagaaatgctcc
gcctgccacaaactcgaagccggtgaaaacgccaccggtccatatctctatggggtggtt
gatcgcccgatcgccgctgcggatggctttggatactctgccaccctggccggtcttggc
ggcgaatggaccgcagaagagttggatgccttcctgaccaaaccgtcacaatatgcgcct
ggtaccaccatgagctttagcgggctgaagaagcagaaggaccgggtgaacctgatcgcc
tatctcgatagcctcgacgattga

DBGET integrated database retrieval system